General Information

    • DRAMP ID

    • DRAMP00207

    • Peptide Name

    • Acidocin B (Bacteriocin)

    • Source

    • Lactobacillus acidophilus M46 (Gram-positive bacteria)

    • Family

    • Not found

    • Gene

    • acdB

    • Sequence

    • IYWIADQFGIHLATGTARKLLDAVASGASLGTAFAAILGVTLPAWALAAAGALGATAA

    • Sequence Length

    • 58

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Listeria monocytogenes, Clostridium sporogenes, Brochothrix thermosphacta, Lactobacillus fermentum, Lactobacillus delbrueckii subsp. Bulgaricus. Inmost other Lactobacillus species.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • No specific N-terminal

    • C-terminal Modification

    • No specific C-terminal

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00207 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP00207.

Physicochemical Information

    • Formula

    • C261H411N67O72

    • Absent Amino Acids

    • CEMN

    • Common Amino Acids

    • A

    • Mass

    • 5639.54

    • PI

    • 6.75

    • Basic Residues

    • 3

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 36

    • Net Charge

    • +1

    • Boman Index

    • 49

    • Hydrophobicity

    • 1.036

    • Aliphatic Index

    • 121.72

    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12490

    • Absorbance 280nm

    • 219.12

    • Polar Residues

    • 15

DRAMP00207

DRAMP00207 chydropathy plot

Comments Information

    • Function

    • Acidocin B is active against Listeria monocytogenes, Clostridium sporogenes, Brochothrix thermosphacta, Lactobacillus fermentum and Lactobacillus delbrueckii subsp. bulgaricus, but inactive against most other Lactobacillus species.

Literature Information

  • ·Literature 1

    • Title

    • Genetic analysis of acidocin B, a novel bacteriocin produced by Lactobacillus acidophilus.

    • Reference

    • Microbiology. 1995 Jul;141 (Pt 7):1629-1635.

    • Author

    • Leer RJ, van der Vossen JM, van Giezen M, van Noort JM, Pouwels PH.