General Information

    • DRAMP ID

    • DRAMP00209

    • Peptide Name

    • Fulvocin C (Bacteriocin)

    • Source

    • Myxococcus fulvus (Gram-negative bacteria)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • ANCSCSTASDYCPILTFCTTGTACSYTPTGCGTGWVYCACNGNFY

    • Sequence Length

    • 45

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Unknown

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00209 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00209.

Physicochemical Information

    • Formula

    • C198H285N49O67S8

    • Absent Amino Acids

    • EHKMQR

    • Common Amino Acids

    • CT

    • Mass

    • 4680.21

    • PI

    • 3.8

    • Basic Residues

    • 0

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 10

    • Net Charge

    • -1

    • Boman Index

    • -19.01

    • Hydrophobicity

    • 0.249

    • Aliphatic Index

    • 32.67

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 11960

    • Absorbance 280nm

    • 271.82

    • Polar Residues

    • 32

DRAMP00209

DRAMP00209 chydropathy plot

Comments Information

    • Function

    • Bacteriocin.

Literature Information

  • ·Literature 1

    • Title

    • The primary structure of fulvocin C from Myxococcus fulvus.

    • Reference

    • Biochim Biophys Acta. 1981 Jan 30;667(1):213-217.

    • Author

    • Tsai H, Hirsch HJ.