General Information

    • DRAMP ID

    • DRAMP00211

    • Peptide Name

    • Sublancin-168 (Bacteriocin)

    • Source

    • Bacillus phage SPbeta (Bacillus phage SPBc2) (Bacteriophage SP-beta)

    • Family

    • Not found

    • Gene

    • sunA

    • Sequence

    • GLGKAQCAALWLQCASGGTIGCGGGAVACQNYRQFCR

    • Sequence Length

    • 37

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Unknown

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00211 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP00211.

Physicochemical Information

    • Formula

    • C156H248N50O46S5

    • Absent Amino Acids

    • DEHMP

    • Common Amino Acids

    • G

    • Mass

    • 3720.29

    • PI

    • 8.8

    • Basic Residues

    • 3

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +3

    • Boman Index

    • -16.49

    • Hydrophobicity

    • 0.241

    • Aliphatic Index

    • 66.22

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7240

    • Absorbance 280nm

    • 201.11

    • Polar Residues

    • 17

DRAMP00211

DRAMP00211 chydropathy plot

Comments Information

    • Function

    • Bacteriocin active against Gram-positive bacteria. Inhibits B. cereus spore outgrowth, after the germination stage, approximately 1000-fold better than it inhibits exponential growth of the same cells. Inhibits B.subtilis strain ATCC 6633 (By similarity).

    • PTM

    • Production of active sublancin-168 requires at least one thiol-disulfide oxidoreductase (BdbB or, in its absence, BdbC). Membrane translocation and cleavage of the precursor are probably performed by SunT (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Nucleotide sequence of the Bacillus subtilis temperate bacteriophage SPbetac2.

    • Reference

    • Microbiology. 1999 May;145 ( Pt 5):1055-1067.

    • Author

    • Lazarevic V, Düsterhöft A, Soldo B, Hilbert H, Mauël C, Karamata D.