General Information

    • DRAMP ID

    • DRAMP00215

    • Peptide Name

    • Enterocin E-760 (Bacteriocin)

    • Source

    • Enterococcus durans/faecium/hirae NRRL B-30745 (Gram-positive bacteria)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • NRWYCNSAAGGVGGAAGCVLAGYVGEAKENIAGEVRKGWGMAGGFTHNKACKSFPGSGWASG

    • Sequence Length

    • 62

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Salmonella enterica serovar Enteritidis, S. enterica serovar Choleraesuis, S. enterica serovar Typhimurium, S. enterica serovar Gallinarum, Escherichia coli O157:H7, Yersinia enterocolitica, Citrobacter freundii, Klebsiella pneumoniae, Shigella dysenteriae, Pseudomonas aeruginosa, Proteus mirabilis, Morganella morganii, Staphylococcus aureus, Staphylococcus epidermidis, Listeria monocytogenes, Campylobacter jejuni, 20 other Campylobacter species isolates.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00215 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00215.

Physicochemical Information

    • Formula

    • C269H403N81O80S4

    • Absent Amino Acids

    • DQ

    • Common Amino Acids

    • G

    • Mass

    • 6179.89

    • PI

    • 8.99

    • Basic Residues

    • 7

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 21

    • Net Charge

    • +4

    • Boman Index

    • -42.8

    • Hydrophobicity

    • -0.177

    • Aliphatic Index

    • 47.42

    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 19605

    • Absorbance 280nm

    • 321.39

    • Polar Residues

    • 29

DRAMP00215

DRAMP00215 chydropathy plot

Comments Information

    • The enterocin demonstrated thermostability by retaining activity after 5 min at 100 degrees C and was stable at pH values between 5.0 and 8.7. However, activity was lost below pH 3.0 and above pH 9.5.

Literature Information

  • ·Literature 1

    • Title

    • Isolation and purification of enterocin E-760 with broad antimicrobial activity against gram-positive and gram-negative bacteria

    • Reference

    • Antimic Agents Chemother 2008 Mar;52(3):1094-1100.

    • Author

    • Line JE, Svetoch EA, Eruslanov BV, Perelygin VV, Mitsevich EV, Mitsevich IP, Levchuk VP, Svetoch OE, Seal BS, Siragusa GR, Stern NJ.