General Information

    • DRAMP ID

    • DRAMP00216

    • Peptide Name

    • Antimicrobial peptide LCI (Bacteriocin)

    • Source

    • Bacillus subtilis (Gram-positive bacteria)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • AIKLVQSPNGNFAASFVLDGTKWIFKSKYYDSSKGYWVGIYEVWDRK

    • Sequence Length

    • 47

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • X. oryzae pv oryzae, R. solanacearum.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • DNA or mRNA

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Beta strand (4 strands; 27 residues)

    • Structure Description

    • The solution structure of LCI has a novel topology, containing a four-strand antiparallel beta-sheet as the dominant secondary structure.

    • Helical Wheel Diagram

    • DRAMP00216 helical wheel diagram

    • PDB ID

    • 2B9K resolved by NMR.

    • Predicted Structure

    • There is no predicted structure for DRAMP00216.

Physicochemical Information

    • Formula

    • C259H378N62O69

    • Absent Amino Acids

    • CHM

    • Common Amino Acids

    • K

    • Mass

    • 5464.22

    • PI

    • 9.4

    • Basic Residues

    • 7

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 18

    • Net Charge

    • +3

    • Boman Index

    • -54.26

    • Hydrophobicity

    • -0.351

    • Aliphatic Index

    • 72.55

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 22460

    • Absorbance 280nm

    • 488.26

    • Polar Residues

    • 16

DRAMP00216

DRAMP00216 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity against X.oryzae pv oryzae and R.solanacearum. May bind DNA or mRNA.

    • Miscellaneous

    • Heat stable. Resistant to proteolysis by tryspin and pepsin, but susceptible to pronase E and proteinase K.

Literature Information

  • ·Literature 1

    • Title

    • Characterization of an anti-rice bacterial blight polypeptide LCI.

    • Reference

    • Rice Genet. Newsl. 1990;7:151-154.

    • Author

    • Liu JY, Pan NS, Chen ZL.
  • ·Literature 2

    • Title

    • Solution structure of LCI, an AMP from Bacillus subtilis.

    • Reference

    • iochemistry. 2011 May 10;50(18):3621-3627.

    • Author

    • Xia, B, Gong, W, Lu, G.