General Information

    • DRAMP ID

    • DRAMP00221

    • Peptide Name

    • Carnobacteriocin-A (Piscicolin-61; Bacteriocin)

    • Source

    • Carnobacterium piscicola (Gram-positive bacteria)

    • Family

    • Not found

    • Gene

    • cbnBA

    • Sequence

    • DQMSDGVNYGKGSSLSKGGAKCGLGIVGGLATIPSGPLGWLAGAAGVINSCMK

    • Sequence Length

    • 53

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Carnobacterium, Enterococcus, Listeria monocytogenes, Clostridium perfringens.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00221 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00221.

Physicochemical Information

    • Formula

    • C217H357N61O69S4

    • Absent Amino Acids

    • EFHR

    • Common Amino Acids

    • G

    • Mass

    • 5052.83

    • PI

    • 8.79

    • Basic Residues

    • 4

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 17

    • Net Charge

    • +2

    • Boman Index

    • 0.77

    • Hydrophobicity

    • 0.259

    • Aliphatic Index

    • 84.72

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7115

    • Absorbance 280nm

    • 136.83

    • Polar Residues

    • 25

DRAMP00221

DRAMP00221 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity.

    • PTM

    • Contains one disulfide bond 22-51.

Literature Information

  • ·Literature 1

    • Title

    • Characteristics and genetic determinant of a hydrophobic peptide bacteriocin, carnobacteriocin A, produced by Carnobacterium piscicola LV17A.

    • Reference

    • Microbiology. 1994 Mar;140 (Pt 3):517-526.

    • Author

    • Worobo RW, Henkel T, Sailer M, Roy KL, Vederas JC, Stiles ME.
  • ·Literature 2

    • Title

    • Purification and cloning of piscicolin 61, a bacteriocin from Carnobacterium piscicola LV61.

    • Reference

    • Curr Microbiol. 1994 Aug;29(2):63-68.

    • Author

    • Holck AL, Axelsson L, Schillinger U.