General Information

    • DRAMP ID

    • DRAMP00229

    • Peptide Name

    • Bacteriocin plantarican ASM1 (PASM1; Bacteriocin)

    • Source

    • Lactobacillus plantarum A-1 (Gram-positive bacteria)

    • Family

    • Not found

    • Gene

    • bactA1

    • Sequence

    • KPAWCWYTLAMCGAGYDSGTCDYMYSHCFGVKHSSGGGGSYHC

    • Sequence Length

    • 43

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Lactobacillus plantarum, L. pentosus, L. curvatus, L. lindneri, Leuconostoc mesenteroides and Enterococcus faecalis.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00229 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP00229.

Physicochemical Information

    • Formula

    • C203H279N53O60S7

    • Absent Amino Acids

    • EINQR

    • Common Amino Acids

    • G

    • Mass

    • 4646.19

    • PI

    • 6.97

    • Basic Residues

    • 5

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +3

    • Boman Index

    • -24.71

    • Hydrophobicity

    • -0.242

    • Aliphatic Index

    • 22.79

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 18700

    • Absorbance 280nm

    • 445.24

    • Polar Residues

    • 25

DRAMP00229

DRAMP00229 chydropathy plot

Comments Information

    • Function

    • Bacteriocin with a narrow antibacterial spectrum. Has Antibacterial activity.

    • Biophysicochemical properties

    • pH dependence (Stable from pH 5.5-8.5); Temperature dependence (Thermostable, activity is retained after incubation at 90degrees Celsius for 15 minutes).

    • PTM

    • Contains two disulfide bonds.

Literature Information

  • ·Literature 1

    • Title

    • Isolation and characterization of plantaricin ASM1: a new bacteriocin produced by Lactobacillus plantarum A-1.

    • Reference

    • Int J Food Microbiol. 2010 Jan 31;137(1):94-99.

    • Author

    • Hata T, Tanaka R, Ohmomo S.