General Information

    • DRAMP ID

    • DRAMP00235

    • Peptide Name

    • AFP1 (Bacteriocin)

    • Source

    • Streptomyces tendae Tu901 (Gram-positive bacteria)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MINRTDCNENSYLEIHNNEGRDTLCFANAGTMPVAIYGVNWVESGNNVVTLQFQRNLSDPRLETITLQKWGSWNPGHIHEILSIRIY

    • Sequence Length

    • 87

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Chitin-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Mature AFP1 comprises 86 residues and contains two antiparallel beta-sheets (five and four beta-strands each), that pack against each other in a parallel beta-sandwich.

    • Helical Wheel Diagram

    • DRAMP00235 helical wheel diagram

    • PDB ID

    • 1G6E resolved by NMR.

    • Predicted Structure

    • There is no predicted structure for DRAMP00235.

Physicochemical Information

    • Formula

    • C439H676N126O134S4

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • N

    • Mass

    • 9991.2

    • PI

    • 5.44

    • Basic Residues

    • 9

    • Acidic Residues

    • 9

    • Hydrophobic Residues

    • 28

    • Net Charge

    • 0

    • Boman Index

    • -158.37

    • Hydrophobicity

    • -0.403

    • Aliphatic Index

    • 87.36

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 21095

    • Absorbance 280nm

    • 245.29

    • Polar Residues

    • 33

DRAMP00235

DRAMP00235 chydropathy plot

Comments Information

    • Function

    • AFP1 is a recently discovered anti-fungal, chitin-binding protein.

Literature Information

  • ·Literature 1

    • Title

    • Characterization of a novel, antifungal, chitin-binding protein from Streptomyces tendae T¼901 that interferes with growth polarity.

    • Reference

    • J Bacteriol. 1999 Dec;181(24):7421-7429.

    • Author

    • Bormann C, Baier D, Hörr I, Raps C, Berger J, Jung G, Schwarz H.
  • ·Literature 2

    • Title

    • Solution structure, backbone dynamics and chitin binding of the anti-fungal protein from Streptomyces tendae TU901.

    • Reference

    • J Mol Biol. 2001 May 11;308(4):765-782.

    • Author

    • Campos-Olivas R, Hörr I, Bormann C, Jung G, Gronenborn AM.