General Information

    • DRAMP ID

    • DRAMP00238

    • Peptide Name

    • Curvaticin FS47 (Bacteriocin)

    • Source

    • Lactobacillus curvatus FS47 (Gram-positive bacteria)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • YTAKQCLQAIGSCGIAGTGAGAAGGPAGAFVGAXVVXI

    • Sequence Length

    • 38

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Listeria monocytogenes, Pediococcus, Enterococcus, Lactobacilli and Bacilli.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00238 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00238.

Physicochemical Information

    • Formula

    • C140H223N39O41S2

    • Absent Amino Acids

    • DEHMNRW

    • Common Amino Acids

    • AG

    • Mass

    • 3431.36

    • PI

    • 8.05

    • Basic Residues

    • 1

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 17

    • Net Charge

    • +1

    • Boman Index

    • 36.78

    • Hydrophobicity

    • 0.903

    • Aliphatic Index

    • 87.63

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:10 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 1615

    • Absorbance 280nm

    • 43.65

    • Polar Residues

    • 15

DRAMP00238

DRAMP00238 chydropathy plot

Comments Information

    • Function

    • Has bacteriocin activity.

Literature Information

  • ·Literature 1

    • Title

    • Purification and partial amino acid sequence of curvaticin FS47, a heat-stable bacteriocin produced by Lactobacillus curvatus FS47.

    • Reference

    • Appl Environ Microbiol. 1994 Jun;60(6):2191-2195.

    • Author

    • Garver KI, Muriana PM.