General Information

    • DRAMP ID

    • DRAMP00248

    • Peptide Name

    • Glycocin F (GccF; S-glycosylated bacteriocin)

    • Source

    • Lactobacillus plantarum KW30 (Gram-positive bacteria)

    • Family

    • Not found

    • Gene

    • gccF

    • Sequence

    • KPAWCWYTLAMCGAGYDSGTCDYMYSHCFGIKHHSSGSSSYHC

    • Sequence Length

    • 43

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacterium: Lactobacillus plantarum ATCC 8014 (IC50=2 nM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Alpha helix (2 helices; 16 residues)

    • Structure Description

    • Glycocin F is a 43-amino acid bacteriocin, which contains two beta-linked N-acetylglucosamine moieties, attached via side chain linkages to a serine via oxygen, and to a cysteine via S-linked sugar. The peptide conformation consists primarily of two alpha-helices held together by a pair of nested disulfide bonds.

    • Helical Wheel Diagram

    • DRAMP00248 helical wheel diagram

    • PDB ID

    • 2KUY resolved by NMR.

    • Predicted Structure

    • There is no predicted structure for DRAMP00248.

Physicochemical Information

    • Formula

    • C210H289N55O62S7

    • Absent Amino Acids

    • ENQRV

    • Common Amino Acids

    • S

    • Mass

    • 4800.36

    • PI

    • 7.04

    • Basic Residues

    • 6

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +4

    • Boman Index

    • -38.11

    • Hydrophobicity

    • -0.319

    • Aliphatic Index

    • 25.12

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 18700

    • Absorbance 280nm

    • 445.24

    • Polar Residues

    • 24

DRAMP00248

DRAMP00248 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity.

    • PTM

    • Contains two disulfide bonds 5-28; 12-21.

Literature Information

  • ·Literature 1

    • Title

    • Structural, dynamic, and chemical characterization of a novel S-glycosylated bacteriocin.

    • Reference

    • Biochemistry. 2011 Apr 12;50(14):2748-2755.

    • Author

    • Venugopal H, Edwards PJ, Schwalbe M, Claridge JK, Libich DS, Stepper J, Loo T, Patchett ML, Norris GE, Pascal SM.
  • ·Literature 2

    • Title

    • Cysteine S-glycosylation, a new post-translational modification found in glycopeptide bacteriocins.

    • Reference

    • FEBS Lett. 2011 Feb 18;585(4):645-650.

    • Author

    • Stepper J, Shastri S, Loo TS, Preston JC, Novak P, Man P, Moore CH, Havl­?ek V, Patchett ML, Norris GE.