General Information

    • DRAMP ID

    • DRAMP00252

    • Peptide Name

    • AdDLP (A. dehalogenans defensin-like peptide; Bacteriocin)

    • Source

    • Anaeromyxobacter dehalogenans (Gram-negative bacteria)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • VNPSYRLDPESRPQCEAHCGQLGMRLGAIVIMGTATGCVCEPKEAATPESR

    • Sequence Length

    • 51

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antibacterial, Antifungal, Antiparasitic, Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Circular dichroism (CD) analysis indicates that recombinant AdDLP adopts a typical structural feature of eukaryotic defensins, which is also consistent with an ab initio structure model predicted using I-TASSER algorithm.

    • Helical Wheel Diagram

    • DRAMP00252 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00252.

Physicochemical Information

    • Formula

    • C226H371N69O74S6

    • Absent Amino Acids

    • FW

    • Common Amino Acids

    • AEGPCR

    • Mass

    • 5431.21

    • PI

    • 5.64

    • Basic Residues

    • 6

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 13

    • Net Charge

    • 0

    • Boman Index

    • -88.14

    • Hydrophobicity

    • -0.326

    • Aliphatic Index

    • 65.1

    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1740

    • Absorbance 280nm

    • 34.8

    • Polar Residues

    • 17

DRAMP00252

DRAMP00252 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • AdDLP, a bacterial defensin-like peptide, exhibits anti-Plasmodium activity.

    • Reference

    • Biochem Biophys Res Commun. 2009 Sep 18;387(2):393-398.

    • Author

    • Gao B, Rodriguez MD, Lanz-Mendoza H, Zhu S.