• DRAMP ID

    • DRAMP00252
    • Peptide Name

    • AdDLP (A. dehalogenans defensin-like peptide; Bacteriocin)
    • Source

    • Anaeromyxobacter dehalogenans (Gram-negative bacteria)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • VNPSYRLDPESRPQCEAHCGQLGMRLGAIVIMGTATGCVCEPKEAATPESR
    • Sequence Length

    • 51
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antibacterial, Antifungal, Antiparasitic, Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Circular dichroism (CD) analysis indicates that recombinant AdDLP adopts a typical structural feature of eukaryotic defensins, which is also consistent with an ab initio structure model predicted using I-TASSER algorithm.
    • Helical Wheel Diagram

    • DRAMP00252 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00252.
    • Formula

    • C226H371N69O74S6
    • Absent Amino Acids

    • FW
    • Common Amino Acids

    • AEGPCR
    • Mass

    • 5431.21
    • PI

    • 5.64
    • Basic Residues

    • 6
    • Acidic Residues

    • 6
    • Hydrophobic Residues

    • 13
    • Net Charge

    • 0
    • Boman Index

    • -88.14
    • Hydrophobicity

    • -0.326
    • Aliphatic Index

    • 65.1
    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1740
    • Absorbance 280nm

    • 34.8
    • Polar Residues

    • 17

DRAMP00252

DRAMP00252 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • AdDLP, a bacterial defensin-like peptide, exhibits anti-Plasmodium activity.
    • Reference

    • Biochem Biophys Res Commun. 2009 Sep 18;387(2):393-398.
    • Author

    • Gao B, Rodriguez MD, Lanz-Mendoza H, Zhu S.