• DRAMP ID

    • DRAMP00252
    • Peptide Name

    • AdDLP (A. dehalogenans defensin-like peptide; Bacteriocin)
    • Source

    • Anaeromyxobacter dehalogenans (Gram-negative bacteria)
    • Family

    • Unknown
    • Gene

    • Unknown
    • Sequence

    • VNPSYRLDPESRPQCEAHCGQLGMRLGAIVIMGTATGCVCEPKEAATPESR
    • Sequence Length

    • 51
    • Swiss_Prot Entry

    • No entry found
    • Evidence code

    • Unknown
    • Biological Activity

    • Antibacterial, Antifungal, Antiparasitic, Antimicrobial
    • Target Organism

      • No MICs found on DRAMP database
    • Hemolytic activity

    • Unknown
    • Binding Target

    • Unknown
    • Structure

    • Unknown
    • Structure Description

    • Circular dichroism (CD) analysis indicates that recombinant AdDLP adopts a typical structural feature of eukaryotic defensins, which is also consistent with an ab initio structure model predicted using I-TASSER algorithm.
    • DRAMP00252 helical wheel diagram
    • Formula

    • C226H371N69O74S6
    • Absent Amino Acids

    • FW
    • Common Amino Acids

    • AEGPCR
    • Mass

    • 6323.24
    • PI

    • 5.7
    • Basic Residues

    • 6
    • Acidic Residues

    • 6
    • Hydrophobic Residues

    • 13
    • Boman Index

    • -88.14
    • Hydrophobicity

    • -32.55
    • Aliphatic Index

    • 65.1
    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1740
    • Absorbance 280nm

    • 34.8
    • Polar Residues

    • 17

DRAMP00252

DRAMP00252 chydropathy plot
    • No comments found on DRAMP database

  • Literature 1
    • Reference

    • Biochem Biophys Res Commun. 2009 Sep 18;387(2):393-398.
    • Author

    • Gao B, Rodriguez MD, Lanz-Mendoza H, Zhu S.
    • Title

    • AdDLP, a bacterial defensin-like peptide, exhibits anti-Plasmodium activity.