• DRAMP ID

    • DRAMP00254
    • Peptide Name

    • Propionicin-F (Bacteriocin)
    • Source

    • Propionibacterium freudenreichii subsp. Freudenreichii LMGT 2946 (Gram-positive bacteria)
    • Family

    • Unknown
    • Gene

    • pcfA
    • Sequence

    • WFYQGMNIAIYANIGGVANIIGYTEAAVATLLGAVVAVAPVVP
    • Sequence Length

    • 43
    • Evidence code

    • Protein level
    • Biological Activity

    • Antibacterial, Anti-Gram+, Antimicrobial
    • Target Organism

      • Gram-positive bacteria: Propionibacterium freudenreichii ssp. freudenreichii ATCC 6207T (MIC=0.7 nM), P. freudenreichii ssp.shermanii ATCC 9614T (MIC=5.0 nM), P. freudenreichii ATCC 9616 (MIC=20 nM), P. freudenreichii IFO12426 (MIC=2.5 nM), P. freudenreichii LMGT 2842 (MIC=5.0 nM), P. freudenreichii LMGT 3001 (MIC=5.0 nM), P. freudenreichii LMGT 2946, P. freudenreichii LMGT 2956, P. freudenreichii ISU-P24 (MIC=0.7 nM), P. freudenreichii ISU-P59 (MIC=2.5 nM), P. freudenreichii ISU-P83 (MIC=5.0 nM), P. freudenreichii ISU-P98 (MIC=1.3 nM), P. freudenreichii ISU-P104 (MIC=0.2 nM).
    • Hemolytic activity

    • Unknown
    • Binding Target

    • Unknown
    • Structure

    • Unknown
    • Structure Description

    • Unknown
    • DRAMP00254 helical wheel diagram
    • Formula

    • C206H318N48O55S
    • Absent Amino Acids

    • CDHKRS
    • Common Amino Acids

    • A
    • Mass

    • 5128.52
    • PI

    • 3.85
    • Basic Residues

    • 0
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 25
    • Boman Index

    • 53.54
    • Hydrophobicity

    • 119.77
    • Aliphatic Index

    • 131.63
    • Half Life

      • Mammalian:2.8 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 9970
    • Absorbance 280nm

    • 237.38
    • Polar Residues

    • 13

DRAMP00254

DRAMP00254 chydropathy plot
    • Function

    • Bacteriocin with specific antibacterial activity.
  • Literature 1
    • Reference

    • Appl Environ Microbiol. 2004 Dec;70(12):7303-7310.
    • Author

    • Brede DA, Faye T, Johnsborg O, Odeg¥rd I, Nes IF, Holo H.
    • Title

    • Molecular and genetic characterization of propionicin F, a bacteriocin from Propionibacterium freudenreichii.