General Information

    • DRAMP ID

    • DRAMP00256

    • Peptide Name

    • Divergicin 750 (Bacteriocin)

    • Source

    • Carnobacterium divergens (Lactobacillus divergens)

    • Family

    • Not found

    • Gene

    • dvn750

    • Sequence

    • KGILGKLGVVQAGVDFVSGVWAGIKQSAKDHPNA

    • Sequence Length

    • 34

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00256 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00256.

Physicochemical Information

    • Formula

    • C156H252N44O44

    • Absent Amino Acids

    • CEMRTY

    • Common Amino Acids

    • G

    • Mass

    • 3447.99

    • PI

    • 9.53

    • Basic Residues

    • 5

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +3

    • Boman Index

    • -10.75

    • Hydrophobicity

    • 0.141

    • Aliphatic Index

    • 100.29

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 166.67

    • Polar Residues

    • 9

DRAMP00256

DRAMP00256 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Divergicin 750, a novel bacteriocin produced by Carnobacterium divergens 750.

    • Reference

    • FEMS Microbiol Lett. 1996 Feb 15;136(2):163-168.

    • Author

    • Holck A, Axelsson L, Schillinger U.