General Information

    • DRAMP ID

    • DRAMP00257

    • Peptide Name

    • Bacteriocin

    • Source

    • Brochothrix campestris

    • Family

    • Not found

    • Gene

    • brcA

    • Sequence

    • MAAFMKLIQFLATKGQKYVSLAWKHKGTILKWINAGQSFEWIYKQIKKLWA

    • Sequence Length

    • 51

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00257 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00257.

Physicochemical Information

    • Formula

    • C291H447N71O65S2

    • Absent Amino Acids

    • CDPR

    • Common Amino Acids

    • K

    • Mass

    • 6044.31

    • PI

    • 10.24

    • Basic Residues

    • 10

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 24

    • Net Charge

    • +9

    • Boman Index

    • -12.56

    • Hydrophobicity

    • -0.02

    • Aliphatic Index

    • 93.92

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 24980

    • Absorbance 280nm

    • 499.6

    • Polar Residues

    • 10

DRAMP00257

DRAMP00257 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Genetic characterization and heterologous expression of brochocin-C, an antibotulinal, two-peptide bacteriocin produced by Brochothrix campestris ATCC 43754.

    • Reference

    • Appl Environ Microbiol. 1998 Dec;64(12):4757-4766.

    • Author

    • McCormick JK, Poon A, Sailer M, Gao Y, Roy KL, McMullen LM, Vederas JC, Stiles ME, Van Belkum MJ.