• DRAMP ID

    • DRAMP00258
    • Peptide Name

    • Lacticin Z (Bacteriocin)
    • Source

    • Lactococcus lactis
    • Family

    • Not found
    • Gene

    • lnqZ
    • Sequence

    • MAGFLKVVQILAKYGSKAVQWAWANKGKILDWINAGQAIDWVVEKIKQILGIK
    • Sequence Length

    • 53
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00258 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00258.
    • Formula

    • C281H447N71O68S
    • Absent Amino Acids

    • CHPRT
    • Common Amino Acids

    • KAI
    • Mass

    • 5940.13
    • PI

    • 9.9
    • Basic Residues

    • 8
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 28
    • Net Charge

    • +5
    • Boman Index

    • -1.29
    • Hydrophobicity

    • 0.276
    • Aliphatic Index

    • 121.51
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 23490
    • Absorbance 280nm

    • 451.73
    • Polar Residues

    • 9

DRAMP00258

DRAMP00258 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Characterization and structure analysis of a novel bacteriocin, lacticin Z, produced by Lactococcus lactis QU 14.
    • Reference

    • Biosci Biotechnol Biochem. 2007 Aug;71(8):1984-1992.
    • Author

    • Iwatani S, Zendo T, Yoneyama F, Nakayama J, Sonomoto K.