• DRAMP ID

    • DRAMP00259
    • Peptide Name

    • Bacteriocin boticin B
    • Source

    • Clostridium botulinum
    • Family

    • Not found
    • Gene

    • btcB
    • Sequence

    • MQKPEIISADLGLCAVNEFVALAAIPGGAATFAVCQMPNLDEIVSNAAYV
    • Sequence Length

    • 50
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00259 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00259.
    • Formula

    • C228H364N56O70S4
    • Absent Amino Acids

    • HRW
    • Common Amino Acids

    • A
    • Mass

    • 5137.97
    • PI

    • 3.83
    • Basic Residues

    • 1
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 25
    • Net Charge

    • -4
    • Boman Index

    • 9.77
    • Hydrophobicity

    • 0.762
    • Aliphatic Index

    • 111.4
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1615
    • Absorbance 280nm

    • 32.96
    • Polar Residues

    • 12

DRAMP00259

DRAMP00259 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Cloning, nucleotide sequence, and expression of the gene encoding the bacteriocin boticin B from Clostridium botulinum strain 213B.
    • Reference

    • Appl Environ Microbiol. 2000 Dec;66(12):5480-5483.
    • Author

    • Dineen SS, Bradshaw M, Johnson EA.