• DRAMP ID

    • DRAMP00260
    • Peptide Name

    • Bacteriocin (Class IIa sec-dependent bacteriocin)
    • Source

    • Enterococcus faecium (Streptococcus faecium)
    • Family

    • Belongs to the Class IIa sec-dependent bacteriocin
    • Gene

    • bacA
    • Sequence

    • TYYGNGLYCNKEKCWVDWNQAKGEIGKIIVNGWVNH
    • Sequence Length

    • 36
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00260 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00260.
    • Formula

    • C191H279N51O53S2
    • Absent Amino Acids

    • FMPRS
    • Common Amino Acids

    • GN
    • Mass

    • 4201.75
    • PI

    • 7.71
    • Basic Residues

    • 5
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 11
    • Net Charge

    • +2
    • Boman Index

    • -43.07
    • Hydrophobicity

    • -0.636
    • Aliphatic Index

    • 70.28
    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 21095
    • Absorbance 280nm

    • 602.71
    • Polar Residues

    • 16

DRAMP00260

DRAMP00260 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Bacteriocin T8, a novel class IIa sec-dependent bacteriocin produced by Enterococcus faecium T8, isolated from vaginal secretions of children infected with human immunodeficiency virus.
    • Reference

    • Appl Environ Microbiol. 2006 Jul;72(7):4761-4766.
    • Author

    • De Kwaadsteniet M, Fraser T, Van Reenen CA, Dicks LM.