General Information

    • DRAMP ID

    • DRAMP00260

    • Peptide Name

    • Bacteriocin (Class IIa sec-dependent bacteriocin)

    • Source

    • Enterococcus faecium (Streptococcus faecium)

    • Family

    • Belongs to the Class IIa sec-dependent bacteriocin

    • Gene

    • bacA

    • Sequence

    • TYYGNGLYCNKEKCWVDWNQAKGEIGKIIVNGWVNH

    • Sequence Length

    • 36

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00260 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00260.

Physicochemical Information

    • Formula

    • C191H279N51O53S2

    • Absent Amino Acids

    • FMPRS

    • Common Amino Acids

    • GN

    • Mass

    • 4201.75

    • PI

    • 7.71

    • Basic Residues

    • 5

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +2

    • Boman Index

    • -43.07

    • Hydrophobicity

    • -0.636

    • Aliphatic Index

    • 70.28

    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 21095

    • Absorbance 280nm

    • 602.71

    • Polar Residues

    • 16

DRAMP00260

DRAMP00260 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Bacteriocin T8, a novel class IIa sec-dependent bacteriocin produced by Enterococcus faecium T8, isolated from vaginal secretions of children infected with human immunodeficiency virus.

    • Reference

    • Appl Environ Microbiol. 2006 Jul;72(7):4761-4766.

    • Author

    • De Kwaadsteniet M, Fraser T, Van Reenen CA, Dicks LM.