General Information

    • DRAMP ID

    • DRAMP00261

    • Peptide Name

    • Antiviral lectin scytovirin (SVN)

    • Source

    • Scytonema varium (cyanobacterium)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GSGPTYCWNEANNPGGPNRCSNNKQCDGARTCSSSGFCQGTSRKPDPGPKGPTYCWDEAKNPGGPNRCSNSKQCDGARTCSSSGFCQGTAGHAAA

    • Sequence Length

    • 95

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00261 helical wheel diagram

    • PDB ID

    • 2QT4 resolved by X-ray.

    • Predicted Structure

    • There is no predicted structure for DRAMP00261.

Physicochemical Information

    • Formula

    • C392H600N132O140S10

    • Absent Amino Acids

    • ILMV

    • Common Amino Acids

    • G

    • Mass

    • 9722.48

    • PI

    • 8.59

    • Basic Residues

    • 11

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +5

    • Boman Index

    • -238.53

    • Hydrophobicity

    • -1.1

    • Aliphatic Index

    • 8.42

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 14605

    • Absorbance 280nm

    • 155.37

    • Polar Residues

    • 53

DRAMP00261

DRAMP00261 chydropathy plot

Comments Information

    • Function

    • Has strong anti-HIV activity against T-tropic strains of HIV-1 and weaker activity against M-tropic strains of HIV-1. Inhibits HIV-1 fusion and infection of CD4 LTR beta-gal cells in vitro. Inhibits fusion of HIV infected CEM-SS cells with uninfected CEM-SS cells, and fusion of HIV-1 Env expressing HL2/3 cells with CD4 LTR beta-gal cells. Binds to HIV gp120, HIV gp160 and to a lesser extent HIV gp41. Binding to HIV gp120 is glycosylation dependent. Binds with high specificity to the tetrasaccharide Man-alpha-1,2-Man-alpha-1,6-Man-alpha-1,6-Man and also binds the higher-order oligosaccharides oligomannose 8 and oligomannose 9. Does not bind to monosaccharides, complex or hybrid N-linked oligosaccharides or chitin.

    • PTM

    • Contains five disulfide bonds.

Literature Information

  • ·Literature 1

    • Title

    • A potent novel anti-HIV protein from the cultured cyanobacterium Scytonema varium.

    • Reference

    • Biochemistry. 2003 Mar 11;42(9):2578-2584.

    • Author

    • Bokesch HR, O'Keefe BR, McKee TC, Pannell LK, Patterson GM, Gardella RS, Sowder RC 2nd, Turpin J, Watson K, Buckheit RW Jr, Boyd MR.
  • ·Literature 2

    • Title

    • Potent anti-HIV activity of scytovirin domain 1 peptide.

    • Reference

    • Peptides. 2006 Jul;27(7):1668-1675.

    • Author

    • Xiong C, O'Keefe BR, Byrd RA, McMahon JB.
  • ·Literature 3

    • Title

    • Atomic-resolution crystal structure of the antiviral lectin scytovirin.

    • Reference

    • Protein Sci. 2007 Dec;16(12):2756-2760.

    • Author

    • Moulaei T, Botos I, Ziółkowska NE, Bokesch HR, Krumpe LR, McKee TC, O'Keefe BR, Dauter Z, Wlodawer A.