General Information

    • DRAMP ID

    • DRAMP00263

    • Peptide Name

    • Bacteriocin cerein 7B

    • Source

    • Bacillus cereus

    • Family

    • Not found

    • Gene

    • cer7B

    • Sequence

    • GWWNSWGKCVAGTIGGAGTGGLGGAAAGSAVPVIGTGIGGAIGGVSGGLTGAATFC

    • Sequence Length

    • 56

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00263 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00263.

Physicochemical Information

    • Formula

    • C215H333N61O66S2

    • Absent Amino Acids

    • DEHMQRY

    • Common Amino Acids

    • G

    • Mass

    • 4892.5

    • PI

    • 8.06

    • Basic Residues

    • 1

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 23

    • Net Charge

    • +1

    • Boman Index

    • 58.06

    • Hydrophobicity

    • 0.729

    • Aliphatic Index

    • 78.57

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 16625

    • Absorbance 280nm

    • 302.27

    • Polar Residues

    • 31

DRAMP00263

DRAMP00263 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Purification and sequencing of cerein 7B, a novel bacteriocin produced by Bacillus cereus Bc7.

    • Reference

    • FEMS Microbiol Lett. 2006 Jan;254(1):108-115.

    • Author

    • Oscáriz JC, Cintas L, Holo H, Lasa I, Nes IF, Pisabarro AG.