• DRAMP ID

    • DRAMP00263
    • Peptide Name

    • Bacteriocin cerein 7B
    • Source

    • Bacillus cereus
    • Family

    • Unknown
    • Gene

    • cer7B
    • Sequence

    • GWWNSWGKCVAGTIGGAGTGGLGGAAAGSAVPVIGTGIGGAIGGVSGGLTGAATFC
    • Sequence Length

    • 56
    • Evidence code

    • Predicted
    • Biological Activity

    • Antimicrobial
    • Target Organism

      • No MICs found on DRAMP database
    • Hemolytic activity

    • Unknown
    • Binding Target

    • Unknown
    • Structure

    • Unknown
    • Structure Description

    • Unknown
    • DRAMP00263 helical wheel diagram
    • Formula

    • C215H333N61O66S2
    • Absent Amino Acids

    • DEHMQRY
    • Common Amino Acids

    • G
    • Mass

    • 5873.77
    • PI

    • 8.23
    • Basic Residues

    • 1
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 23
    • Boman Index

    • 58.06
    • Hydrophobicity

    • 72.86
    • Aliphatic Index

    • 78.57
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 16625
    • Absorbance 280nm

    • 302.27
    • Polar Residues

    • 31

DRAMP00263

DRAMP00263 chydropathy plot
    • No comments found on DRAMP database

  • Literature 1
    • Reference

    • FEMS Microbiol Lett. 2006 Jan;254(1):108-115.
    • Author

    • Oscáriz JC, Cintas L, Holo H, Lasa I, Nes IF, Pisabarro AG.
    • Title

    • Purification and sequencing of cerein 7B, a novel bacteriocin produced by Bacillus cereus Bc7.