General Information

    • DRAMP ID

    • DRAMP00270

    • Peptide Name

    • Osmotin (CpOsm; Plant defensin)

    • Source

    • Calotropis procera (Roostertree) (Asclepias procera)

    • Family

    • Belongs to the thaumatin family

    • Gene

    • Not found

    • Sequence

    • ATFTIRNNCPYTIWAAAVPGGGRRLNSGGTWTINVAPGTA

    • Sequence Length

    • 40

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Fusarium solani (IC50=67.0 µg/ml), Colletotrichum gloeosporioides (IC50=32.1 µg/ml), Neurospora isolate (IC50=57.5 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00270 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00270.

Physicochemical Information

    • Formula

    • C183H283N55O53S

    • Absent Amino Acids

    • DEHKMQ

    • Common Amino Acids

    • AGT

    • Mass

    • 4133.66

    • PI

    • 10.76

    • Basic Residues

    • 3

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +3

    • Boman Index

    • -37.1

    • Hydrophobicity

    • -0.025

    • Aliphatic Index

    • 68.5

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12490

    • Absorbance 280nm

    • 320.26

    • Polar Residues

    • 19

DRAMP00270

DRAMP00270 chydropathy plot

Comments Information

    • Function

    • Has antifungal activity.

    • Miscellaneous

    • On the 2D-gel the determined pI of isoform 1 is

Literature Information

  • ·Literature 1

    • Title

    • Osmotin purified from the latex of Calotropis procera: Biochemical characterization, biological activity and role in plant defense.

    • Reference

    • Plant Physiol Biochem. 2011 Jul;49(7):738-743.

    • Author

    • de Freitas CD, Nogueira FC, Vasconcelos IM, Oliveira JT, Domont GB, Ramos MV.