General Information

    • DRAMP ID

    • DRAMP00273

    • Peptide Name

    • Thaumatin-like protein (Plants)

    • Source

    • Phaseolus vulgaris (Kidney bean) (French bean)

    • Family

    • Belongs to the thaumatin family

    • Gene

    • Not found

    • Sequence

    • ANFEIVNNCPYTVWAAASPGGGRRLDRGQT

    • Sequence Length

    • 30

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Coprinus comatus, Fusarium oxysporum, Pleurotus ostreatus.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00273 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00273.

Physicochemical Information

    • Formula

    • C139H214N44O43S

    • Absent Amino Acids

    • HKM

    • Common Amino Acids

    • AG

    • Mass

    • 3221.56

    • PI

    • 8.27

    • Basic Residues

    • 3

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +1

    • Boman Index

    • -58.92

    • Hydrophobicity

    • -0.483

    • Aliphatic Index

    • 58.67

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 6990

    • Absorbance 280nm

    • 241.03

    • Polar Residues

    • 12

DRAMP00273

DRAMP00273 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • First chromatographic isolation of an antifungal thaumatin-like protein from French bean legumes and demonstration of its antifungal activity.

    • Reference

    • Biochem Biophys Res Commun. 1999 Sep 16;263(1):130-134.

    • Author

    • Ye XY, Wang HX, Ng TB.