General Information

    • DRAMP ID

    • DRAMP00277

    • Peptide Name

    • Potamin-1 (PT-1; Plants)

    • Source

    • Solanum tuberosum (Potato)

    • Family

    • Belongs to the protease inhibitor I20

    • Gene

    • Not found

    • Sequence

    • DICTNCCAGTKGCNTTSANGAFICEGQSDPKKPKACPLNCDPHIAYA

    • Sequence Length

    • 47

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal, Antibacterial, Anti-Gram+

    • Target Organism

      • [Ref.15809084]Fungi: Candida albicans(MIC =100μM) and Rhizoctonia solani(MIC =100μM);
      • Gram-positive bacterium: Clavibacter michiganensis(MIC =50μM)

    • Hemolytic Activity

      • [Ref:15809084]Non-hemolytic activity against human erythrocytes

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00277 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00277.

Physicochemical Information

    • Formula

    • C199H316N58O68S7

    • Absent Amino Acids

    • MRVW

    • Common Amino Acids

    • C

    • Mass

    • 4833.47

    • PI

    • 6.7

    • Basic Residues

    • 5

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +1

    • Boman Index

    • -62.91

    • Hydrophobicity

    • -0.332

    • Aliphatic Index

    • 45.96

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 40.54

    • Polar Residues

    • 22

DRAMP00277

DRAMP00277 chydropathy plot

Comments Information

    • Function

    • Inhibitor of serine proteases chymotrypsin, papain and trypsin. Has strong antifungal activity against C. albicans and R.solani. Has antibacterial activity against the Gram-positive bacterium C.michiganense, but Non-antibacterial activity against the Gram-positive bacterium S. aureus. Lacks hemolytic activity against human erythrocytes.

    • PTM

    • Contains four disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Antimicrobial activity studies on a trypsin-chymotrypsin protease inhibitor obtained from potato.

    • Reference

    • Biochem Biophys Res Commun. 2005 May 13;330(3):921-927.

    • Author

    • Kim JY, Park SC, Kim MH, Lim HT, Park Y, Hahm KS.