General Information

    • DRAMP ID

    • DRAMP00279

    • Peptide Name

    • Plastocyanin (Plants)

    • Source

    • Ulva pertusa (Sea lettuce)

    • Family

    • Not found

    • Gene

    • PETE

    • Sequence

    • AQIVKLGGDDGSLAFVPSKISVAAGEAIEFVNNAGFPHNIVFDEDAVPAGVDADAISYDDYLNSKGETVVRKLSTPGVYGVYCEPHAGAGMKMTITVQ

    • Sequence Length

    • 98

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00279 helical wheel diagram

    • PDB ID

    • 1IUZ resolved by X-ray.

    • Predicted Structure

    • There is no predicted structure for DRAMP00279.

Physicochemical Information

    • Formula

    • C453H702N116O145S3

    • Absent Amino Acids

    • W

    • Common Amino Acids

    • AVG

    • Mass

    • 10189.43

    • PI

    • 4.43

    • Basic Residues

    • 8

    • Acidic Residues

    • 13

    • Hydrophobic Residues

    • 38

    • Net Charge

    • -5

    • Boman Index

    • -77.04

    • Hydrophobicity

    • 0.098

    • Aliphatic Index

    • 87.55

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5960

    • Absorbance 280nm

    • 61.44

    • Polar Residues

    • 30

DRAMP00279

DRAMP00279 chydropathy plot

Comments Information

    • Function

    • Participates in electron transfer between P700 and the cytochrome b6-f complex in photosystem I. Has antiviral activity against Potato virus Y (strain N).

    • Domain

    • Contains 1 plastocyanin-like domain.

Literature Information

  • ·Literature 1

    • Title

    • Novel insight into the copper-ligand geometry in the crystal structure of Ulva pertusa plastocyanin at 1.6-A resolution. Structural basis for regulation of the copper site by residue 88.

    • Reference

    • J Biol Chem. 1999 Feb 12;274(7):4225-4230.

    • Author

    • Shibata N, Inoue T, Nagano C, Nishio N, Kohzuma T, Onodera K, Yoshizaki F, Sugimura Y, Kai Y.