General Information

    • DRAMP ID

    • DRAMP00280

    • Peptide Name

    • Trypsin inhibitor (FtTI; Plant defensin)

    • Source

    • Fagopyrum tataricum (Tartarian buckwheat) (Polygonum tataricum)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • LIYAKVECLTTGVRTYVGKQSWPELVGTKGKTAAATIDKENTHVTAVLCPPLTTLAACRTFDFRCDRVRVLINRIGGVVTKTPTVG

    • Sequence Length

    • 86

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: M. melonis, A. cucumerina, A. solani, C. glaeosporioides and P. capsici.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00280 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00280.

Physicochemical Information

    • Formula

    • C412H682N116O119S4

    • Absent Amino Acids

    • M

    • Common Amino Acids

    • T

    • Mass

    • 9292.89

    • PI

    • 9.51

    • Basic Residues

    • 13

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 32

    • Net Charge

    • +7

    • Boman Index

    • -101.33

    • Hydrophobicity

    • 0.123

    • Aliphatic Index

    • 95.12

    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 8730

    • Absorbance 280nm

    • 102.71

    • Polar Residues

    • 30

DRAMP00280

DRAMP00280 chydropathy plot

Comments Information

    • Function

    • Serine protease inhibitor which is active against trypsin. Displays strong antifungal activity against a number of phytopathogenic fungi.

    • Biophysicochemical properties

    • pH dependence (Optimum pH is 8.0 at 37 degrees Celsius. Maintains over 90% of its inhibitory activity from pH 3 to 10); Temperature dependence (Active between 10 and 60 degrees Celsius. 84% activity retained when heated for 30 minutes at 80 degrees Celsius. Incubation at temperatures above 80 degrees Celsius rapidly decreases inhibitory activity).

    • PTM

    • Contains two disulfide bonds 8-65; 49-58.

Literature Information

  • ·Literature 1

    • Title

    • Identification and Characterization of a Trypsin Inhibitor from Fagopyrum tataricum Seeds.

    • Reference

    • Appl Biochem Biotechnol. 2011 May 5.

    • Author

    • Ruan JJ, Zhou ML, Chen H, Shao JR.