General Information

    • DRAMP ID

    • DRAMP00281

    • Peptide Name

    • Defensin-like protein 230 (Disease resistance response protein 230; Plant defensin)

    • Source

    • Pisum sativum (Garden pea)

    • Family

    • Belongs to the DEFL family

    • Gene

    • PI230

    • Sequence

    • NTCENLAGSYKGVCFGGCDRHCRTQEGAISGRCRDDFRCWCTKNC

    • Sequence Length

    • 45

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Unknown

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00281 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00281.

Physicochemical Information

    • Formula

    • C202H315N69O66S8

    • Absent Amino Acids

    • MP

    • Common Amino Acids

    • C

    • Mass

    • 5022.63

    • PI

    • 8.21

    • Basic Residues

    • 8

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +3

    • Boman Index

    • -128.58

    • Hydrophobicity

    • -0.702

    • Aliphatic Index

    • 28.22

    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7490

    • Absorbance 280nm

    • 170.23

    • Polar Residues

    • 23

DRAMP00281

DRAMP00281 chydropathy plot

Comments Information

    • Function

    • Has antifungal activity (By similarity).

    • Induction

    • Upon contact with the plant pathogen fungus Fusarium solani.

    • PTM

    • Contains four disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • The Fusarium solani-induced expression of a pea gene family encoding high cysteine content proteins.

    • Reference

    • Mol Plant Microbe Interact. 1991 Jul-Aug;4(4):324-331.

    • Author

    • Chiang CC, Hadwiger LA.