General Information

    • DRAMP ID

    • DRAMP00282

    • Peptide Name

    • Defensin-like protein P322 (Probable protease inhibitor P322; Plant defensin)

    • Source

    • Solanum tuberosum (Potato)

    • Family

    • Belongs to the DEFL family

    • Gene

    • Not found

    • Sequence

    • GPMRIAEARHCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGFRRRCFCTKPC

    • Sequence Length

    • 55

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00282 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00282.

Physicochemical Information

    • Formula

    • C253H401N89O76S9

    • Absent Amino Acids

    • QWY

    • Common Amino Acids

    • CR

    • Mass

    • 6194.06

    • PI

    • 8.97

    • Basic Residues

    • 13

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +8

    • Boman Index

    • -169.87

    • Hydrophobicity

    • -0.724

    • Aliphatic Index

    • 24.91

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 500

    • Absorbance 280nm

    • 9.26

    • Polar Residues

    • 23

DRAMP00282

DRAMP00282 chydropathy plot

Comments Information

    • Function

    • May have antifungal activity.

    • PTM

    • Contains four disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Molecular cloning and analysis of four potato tuber mRNAs.

    • Reference

    • Plant Molecular Biology. 1988, 11(3):255-269.

    • Author

    • Stiekema WJ, Heidekamp F, Dirkse WG, van Beckum J, de Haan P, ten Bosch C, Louwerse JD.