• DRAMP ID

    • DRAMP00282
    • Peptide Name

    • Defensin-like protein P322 (Probable protease inhibitor P322; Plant defensin)
    • Source

    • Solanum tuberosum (Potato)
    • Family

    • Belongs to the DEFL family
    • Gene

    • Unknown
    • Sequence

    • GPMRIAEARHCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGFRRRCFCTKPC
    • Sequence Length

    • 55
    • Evidence code

    • Transcript level
    • Biological Activity

    • Antifungal
    • Target Organism

      • No MICs found on DRAMP database
    • Hemolytic activity

    • Unknown
    • Binding Target

    • Unknown
    • Structure

    • Unknown
    • Structure Description

    • Unknown
    • DRAMP00282 helical wheel diagram
    • Formula

    • C253H401N89O76S9
    • Absent Amino Acids

    • QWY
    • Common Amino Acids

    • CR
    • Mass

    • 7157.4
    • PI

    • 8.61
    • Basic Residues

    • 13
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 10
    • Boman Index

    • -169.87
    • Hydrophobicity

    • -72.36
    • Aliphatic Index

    • 24.91
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 500
    • Absorbance 280nm

    • 9.26
    • Polar Residues

    • 23

DRAMP00282

DRAMP00282 chydropathy plot
    • Function

    • May have antifungal activity.
    • PTM

    • Contains four disulfide bonds (By similarity).
  • Literature 1
    • Reference

    • Plant Molecular Biology. 1988, 11(3):255-269.
    • Author

    • Stiekema WJ, Heidekamp F, Dirkse WG, van Beckum J, de Haan P, ten Bosch C, Louwerse JD.
    • Title

    • Molecular cloning and analysis of four potato tuber mRNAs.