• DRAMP ID

    • DRAMP00283
    • Peptide Name

    • Defensin Ec-AMP-D1 (Plant defensin)
    • Source

    • Echinochloa crus-galli (Barnyard grass) (Panicum crus-galli)
    • Family

    • Belongs to the DEFL family
    • Gene

    • Not found
    • Sequence

    • RECQSQSHRYKGACVHDTNCASVCQTEGFSGGKCVGFRGRCFCTKAC
    • Sequence Length

    • 47
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antifungal
    • Target Organism

      • Fungi: Fusarium graminearum (IC50=15 µg/ml), Fusarium oxysporum (IC50=102 µg/ml), F. verticillioides (IC50=8.5 µg/ml), Diplodia maydis (IC50=12.5 µg/ml).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00283 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00283.
    • Formula

    • C207H326N70O66S8
    • Absent Amino Acids

    • ILMPW
    • Common Amino Acids

    • C
    • Mass

    • 5107.78
    • PI

    • 8.74
    • Basic Residues

    • 9
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 9
    • Net Charge

    • +6
    • Boman Index

    • -110.33
    • Hydrophobicity

    • -0.494
    • Aliphatic Index

    • 24.89
    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 1990
    • Absorbance 280nm

    • 43.26
    • Polar Residues

    • 23

DRAMP00283

DRAMP00283 chydropathy plot
    • Function

    • Has antifungal activity. Inhibits hyphal development in P. infestans (IC50=25.5 µg/ml), but not release of zoospores. At concentrations above 100 µg/ml, induces morphological changes such as lysis of hyphae and sporangia in P. infestans.
    • PTM

    • Contains four disulfide bonds (By similarity).
  • ·Literature 1
    • Title

    • Seed defensins of barnyard grass Echinochloa crusgalli (L.) Beauv.
    • Reference

    • Biochimie. 2008 Nov-Dec;90(11-12):1667-1673.
    • Author

    • Odintsova TI, Rogozhin EA, Baranov Y, Musolyamov AKh, Yalpani N, Egorov TA, Grishin EV.