• DRAMP ID

    • DRAMP00284
    • Peptide Name

    • Defensin-like protein 1 (SI alpha-1; Plant defensin)
    • Source

    • Sorghum bicolor (Sorghum) (Sorghum vulgare)
    • Family

    • Belongs to the DEFL family
    • Gene

    • Not found
    • Sequence

    • RVCMGKSQHHSFPCISDRLCSNECVKEEGGWTAGYCHLRYCRCQKAC
    • Sequence Length

    • 47
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antifungal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00284 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00284.
    • Formula

    • C223H348N72O66S9
    • Absent Amino Acids

    • ?
    • Common Amino Acids

    • C
    • Mass

    • 5382.2
    • PI

    • 8.51
    • Basic Residues

    • 10
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 9
    • Net Charge

    • +6
    • Boman Index

    • -105.51
    • Hydrophobicity

    • -0.545
    • Aliphatic Index

    • 41.49
    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 8980
    • Absorbance 280nm

    • 195.22
    • Polar Residues

    • 20

DRAMP00284

DRAMP00284 chydropathy plot
    • Function

    • Has antifungal activity (By similarity).
    • PTM

    • Contains four disulfide bonds 3-47; 14-36; 20-41; 24-43.
  • ·Literature 1
    • Title

    • A new family of small (5 kDa) protein inhibitors of insect alpha-amylases from seeds or sorghum (Sorghum bicolar (L) Moench) have sequence homologies with wheat gamma-purothionins.
    • Reference

    • FEBS Lett. 1991 Feb 11;279(1):101-104.
    • Author

    • Bloch C Jr, Richardson M.
  • ·Literature 2
    • Title

    • Amino acid sequence and disulphide-bridge pattern of three gamma-thionins from Sorghum bicolor.
    • Reference

    • Eur J Biochem. 1995 Mar 1;228(2):250-256.
    • Author

    • Nitti G, Orrù S, Bloch C Jr, Morhy L, Marino G, Pucci P.