• DRAMP ID

    • DRAMP00286
    • Peptide Name

    • Defensin-like protein 3 (SI alpha-3; Plant defensin)
    • Source

    • Sorghum bicolor (Sorghum) (Sorghum vulgare)
    • Family

    • Belongs to the DEFL family
    • Gene

    • Unknown
    • Sequence

    • RVCRRRSAGFKGLCMSDHNCAQVCLQEGWGGGNCDGVIRQCKCIRQC
    • Sequence Length

    • 47
    • Evidence code

    • Protein level
    • Biological Activity

    • Antifungal, Antimicrobial
    • Target Organism

      • No MICs found on DRAMP database
    • Hemolytic activity

    • Unknown
    • Binding Target

    • Unknown
    • Structure

    • Unknown
    • Structure Description

    • Unknown
    • DRAMP00286 helical wheel diagram
    • Formula

    • C209H346N76O62S9
    • Absent Amino Acids

    • PTY
    • Common Amino Acids

    • C
    • Mass

    • 6024.78
    • PI

    • 8.61
    • Basic Residues

    • 9
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 11
    • Boman Index

    • -111.87
    • Hydrophobicity

    • -36.81
    • Aliphatic Index

    • 55.96
    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 6000
    • Absorbance 280nm

    • 130.43
    • Polar Residues

    • 19

DRAMP00286

DRAMP00286 chydropathy plot
    • Function

    • Has antifungal activity (By similarity).
    • PTM

    • Contains four disulfide bonds 3-47; 14-34; 20-41; 24-43.
  • Literature 1
    • Reference

    • FEBS Lett. 1991 Feb 11;279(1):101-104.
    • Author

    • Bloch C Jr, Richardson M.
    • Title

    • A new family of small (5 kDa) protein inhibitors of insect alpha-amylases from seeds or sorghum (Sorghum bicolar (L) Moench) have sequence homologies with wheat gamma-purothionins.
  • Literature 2
    • Reference

    • Eur J Biochem. 1995 Mar 1;228(2):250-256.
    • Author

    • Nitti G, Orrù S, Bloch C Jr, Morhy L, Marino G, Pucci P.
    • Title

    • Amino acid sequence and disulphide-bridge pattern of three gamma-thionins from Sorghum bicolor.