General Information

    • DRAMP ID

    • DRAMP00286

    • Peptide Name

    • Defensin-like protein 3 (SI alpha-3; Plant defensin)

    • Source

    • Sorghum bicolor (Sorghum) (Sorghum vulgare)

    • Family

    • Belongs to the DEFL family

    • Gene

    • Not found

    • Sequence

    • RVCRRRSAGFKGLCMSDHNCAQVCLQEGWGGGNCDGVIRQCKCIRQC

    • Sequence Length

    • 47

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00286 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00286.

Physicochemical Information

    • Formula

    • C209H346N76O62S9

    • Absent Amino Acids

    • PTY

    • Common Amino Acids

    • C

    • Mass

    • 5204.06

    • PI

    • 8.97

    • Basic Residues

    • 9

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +6

    • Boman Index

    • -111.87

    • Hydrophobicity

    • -0.368

    • Aliphatic Index

    • 55.96

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 6000

    • Absorbance 280nm

    • 130.43

    • Polar Residues

    • 19

DRAMP00286

DRAMP00286 chydropathy plot

Comments Information

    • Function

    • Has antifungal activity (By similarity).

    • PTM

    • Contains four disulfide bonds 3-47; 14-34; 20-41; 24-43.

Literature Information

  • ·Literature 1

    • Title

    • A new family of small (5 kDa) protein inhibitors of insect alpha-amylases from seeds or sorghum (Sorghum bicolar (L) Moench) have sequence homologies with wheat gamma-purothionins.

    • Reference

    • FEBS Lett. 1991 Feb 11;279(1):101-104.

    • Author

    • Bloch C Jr, Richardson M.
  • ·Literature 2

    • Title

    • Amino acid sequence and disulphide-bridge pattern of three gamma-thionins from Sorghum bicolor.

    • Reference

    • Eur J Biochem. 1995 Mar 1;228(2):250-256.

    • Author

    • Nitti G, Orrù S, Bloch C Jr, Morhy L, Marino G, Pucci P.