• DRAMP ID

    • DRAMP00288
    • Peptide Name

    • Defensin Ec-AMP-D2 (Plant defensin)
    • Source

    • Echinochloa crus-galli (Barnyard grass) (Panicum crus-galli)
    • Family

    • Belongs to the DEFL family
    • Gene

    • Unknown
    • Sequence

    • RECQSQSHRYKGACVHDTNCASVCQTEGFSGGKCVGFRGRCFCTKHC
    • Sequence Length

    • 47
    • Evidence code

    • Protein level
    • Biological Activity

    • Antifungal, Antimicrobial
    • Target Organism

      • No MICs found on DRAMP database
    • Hemolytic activity

    • Unknown
    • Binding Target

    • Unknown
    • Structure

    • Unknown
    • Structure Description

    • Unknown
    • DRAMP00288 helical wheel diagram
    • Formula

    • C210H328N72O66S8
    • Absent Amino Acids

    • ILMPW
    • Common Amino Acids

    • C
    • Mass

    • 5994.52
    • PI

    • 8.41
    • Basic Residues

    • 10
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 8
    • Boman Index

    • -116.8
    • Hydrophobicity

    • -60
    • Aliphatic Index

    • 22.77
    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 1990
    • Absorbance 280nm

    • 43.26
    • Polar Residues

    • 23

DRAMP00288

DRAMP00288 chydropathy plot
    • Function

    • Has antifungal activity. Inhibits spore germination in Fusarium oxysporum (IC(50)=102 μg/ml). Inhibits hyphal development in P. infestans (IC(50)=50 μg/ml). Does not induce morphological changes such as lysis of hyphae and sporangia in P. infestans.
    • PTM

    • Contains four disulfide bonds (By similarity).
  • Literature 1
    • Reference

    • Biochimie. 2008 Nov-Dec;90(11-12):1667-1673.
    • Author

    • Odintsova TI, Rogozhin EA, Baranov Y, Musolyamov AKh, Yalpani N, Egorov TA, Grishin EV.
    • Title

    • Seed defensins of barnyard grass Echinochloa crusgalli (L.) Beauv.