General Information

    • DRAMP ID

    • DRAMP00288

    • Peptide Name

    • Defensin Ec-AMP-D2 (Plant defensin)

    • Source

    • Echinochloa crus-galli (Barnyard grass) (Panicum crus-galli)

    • Family

    • Belongs to the DEFL family

    • Gene

    • Not found

    • Sequence

    • RECQSQSHRYKGACVHDTNCASVCQTEGFSGGKCVGFRGRCFCTKHC

    • Sequence Length

    • 47

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00288 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00288.

Physicochemical Information

    • Formula

    • C210H328N72O66S8

    • Absent Amino Acids

    • ILMPW

    • Common Amino Acids

    • C

    • Mass

    • 5173.84

    • PI

    • 8.74

    • Basic Residues

    • 10

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +7

    • Boman Index

    • -116.8

    • Hydrophobicity

    • -0.6

    • Aliphatic Index

    • 22.77

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 1990

    • Absorbance 280nm

    • 43.26

    • Polar Residues

    • 23

DRAMP00288

DRAMP00288 chydropathy plot

Comments Information

    • Function

    • Has antifungal activity. Inhibits spore germination in Fusarium oxysporum (IC(50)=102 μg/ml). Inhibits hyphal development in P. infestans (IC(50)=50 μg/ml). Does not induce morphological changes such as lysis of hyphae and sporangia in P. infestans.

    • PTM

    • Contains four disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Seed defensins of barnyard grass Echinochloa crusgalli (L.) Beauv.

    • Reference

    • Biochimie. 2008 Nov-Dec;90(11-12):1667-1673.

    • Author

    • Odintsova TI, Rogozhin EA, Baranov Y, Musolyamov AKh, Yalpani N, Egorov TA, Grishin EV.