General Information

    • DRAMP ID

    • DRAMP00291

    • Peptide Name

    • Defensin-like protein (Gamma-thionin homolog; Plant defensin)

    • Source

    • Nelumbo nucifera (Sacred lotus)

    • Family

    • Belongs to the DEFL family

    • Gene

    • Not found

    • Sequence

    • RTCESQSHRFKGACLSDTNCASVCQTEGFPAGDCKGARRRCFCVKPC

    • Sequence Length

    • 47

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00291 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00291.

Physicochemical Information

    • Formula

    • C207H334N70O66S8

    • Absent Amino Acids

    • IMWY

    • Common Amino Acids

    • C

    • Mass

    • 5115.84

    • PI

    • 8.75

    • Basic Residues

    • 9

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +5

    • Boman Index

    • -122.82

    • Hydrophobicity

    • -0.515

    • Aliphatic Index

    • 29.15

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 500

    • Absorbance 280nm

    • 10.87

    • Polar Residues

    • 20

DRAMP00291

DRAMP00291 chydropathy plot

Comments Information

    • Function

    • Has antifungal activity (By similarity).

    • PTM

    • Contains four disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Not found

    • Reference

    • Submitted (FEB-2007) to the EMBL/GenBank/DDBJ database

    • Author

    • Not found
  • ·Literature 2

    • Title

    • Purification, characterization, and antifungal activity of chitinase from Streptomyces venezuelae P(10).

    • Reference

    • Curr Microbiol. 2006 Oct;53(4):265-269.

    • Author

    • Mukherjee G, Sen SK.