• DRAMP ID

    • DRAMP00291
    • Peptide Name

    • Defensin-like protein (Gamma-thionin homolog; Plant defensin)
    • Source

    • Nelumbo nucifera (Sacred lotus)
    • Family

    • Belongs to the DEFL family
    • Gene

    • Unknown
    • Sequence

    • RTCESQSHRFKGACLSDTNCASVCQTEGFPAGDCKGARRRCFCVKPC
    • Sequence Length

    • 47
    • Evidence code

    • Homology
    • Biological Activity

    • Antifungal, Antimicrobial
    • Target Organism

      • No MICs found on DRAMP database
    • Hemolytic activity

    • Unknown
    • Binding Target

    • Unknown
    • Structure

    • Unknown
    • Structure Description

    • Unknown
    • DRAMP00291 helical wheel diagram
    • Formula

    • C207H334N70O66S8
    • Absent Amino Acids

    • IMWY
    • Common Amino Acids

    • C
    • Mass

    • 5936.52
    • PI

    • 8.41
    • Basic Residues

    • 9
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 10
    • Boman Index

    • -122.82
    • Hydrophobicity

    • -51.49
    • Aliphatic Index

    • 29.15
    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 500
    • Absorbance 280nm

    • 10.87
    • Polar Residues

    • 20

DRAMP00291

DRAMP00291 chydropathy plot
    • Function

    • Has antifungal activity (By similarity).
    • PTM

    • Contains four disulfide bonds (By similarity).
  • Literature 1
    • Reference

    • Submitted (FEB-2007) to the EMBL/GenBank/DDBJ database
    • Author

    • Unknown
    • Title

    • Unknown
  • Literature 2
    • Reference

    • Curr Microbiol. 2006 Oct;53(4):265-269.
    • Author

    • Mukherjee G, Sen SK.
    • Title

    • Purification, characterization, and antifungal activity of chitinase from Streptomyces venezuelae P(10).