• DRAMP ID

    • DRAMP00293
    • Peptide Name

    • Gamma1-hordothionin (Gamma 1-H; Plant defensin)
    • Source

    • Hordeum vulgare (Barley)
    • Family

    • Belongs to the DEFL family
    • Gene

    • Unknown
    • Sequence

    • RICRRRSAGFKGPCVSNKNCAQVCMQEGWGGGNCDGPLRRCKCMRRC
    • Sequence Length

    • 47
    • Evidence code

    • Protein level
    • Biological Activity

    • Antifungal, Antimicrobial
    • Target Organism

      • No MICs found on DRAMP database
    • Hemolytic activity

    • Unknown
    • Binding Target

    • Unknown
    • Structure

    • Combine helix and strand structure
    • Structure Description

    • Gamma 1-H adopts a well-defined triple-stranded antiparallel beta-sheet (residues 1-6, 31-34, and 39-47), an alpha-helix (residues 16-28), and the corresponding connecting loops. Three disulfide bridges are located in the hydrophobic core holding together the alpha-helix and the beta-sheet and forming a cysteine-stabilized alpha-helical (CSH) motif.
    • PDB ID

    • 1GPT resolved by NMR.
    • DRAMP00293 helical wheel diagram
    • Formula

    • C209H352N80O59S10
    • Absent Amino Acids

    • HTY
    • Common Amino Acids

    • CR
    • Mass

    • 6070.88
    • PI

    • 9.9
    • Basic Residues

    • 11
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 8
    • Boman Index

    • -140.97
    • Hydrophobicity

    • -71.91
    • Aliphatic Index

    • 33.19
    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 6000
    • Absorbance 280nm

    • 130.43
    • Polar Residues

    • 20

DRAMP00293

DRAMP00293 chydropathy plot
    • Function

    • Inhibits protein translation in cell-free systems.
    • PTM

    • Contains four disulfide bonds 3-47; 14-34; 20-21; 24-43.
    • Caution

    • Was initially thought to be a thionin.
  • Literature 1
    • Reference

    • Eur I Biochem 1990;194:533-539.
    • Author

    • Mendez E, Moreno A, Colilla F.J, Pelaez F, Limas G.G, Mendez R, Soriano F, Salinas M, de Haro C.
    • Title

    • Primary structure and inhibition of protein synthesis in eukaryotic cell-free system of a novel thionin, gamma-hordothionin, from barley endosperm.
  • Literature 2
    • Reference

    • Biochemistry. 1993 Jan 19;32(2):715-724.
    • Author

    • Bruix M, Jim©nez MA, Santoro J, Gonz¡lez C, Colilla FJ, M©ndez E, Rico M.
    • Title

    • Solution structure of gamma 1-H and gamma 1-P thionins from barley and wheat endosperm determined by 1H-NMR: a structural motif common to toxic arthropod proteins.