General Information

    • DRAMP ID

    • DRAMP00293

    • Peptide Name

    • Gamma1-hordothionin (Gamma 1-H; Plant defensin)

    • Source

    • Hordeum vulgare (Barley)

    • Family

    • Belongs to the DEFL family

    • Gene

    • Not found

    • Sequence

    • RICRRRSAGFKGPCVSNKNCAQVCMQEGWGGGNCDGPLRRCKCMRRC

    • Sequence Length

    • 47

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Gamma 1-H adopts a well-defined triple-stranded antiparallel beta-sheet (residues 1-6, 31-34, and 39-47), an alpha-helix (residues 16-28), and the corresponding connecting loops. Three disulfide bridges are located in the hydrophobic core holding together the alpha-helix and the beta-sheet and forming a cysteine-stabilized alpha-helical (CSH) motif.

    • Helical Wheel Diagram

    • DRAMP00293 helical wheel diagram

    • PDB ID

    • 1GPT resolved by NMR.

    • Predicted Structure

    • There is no predicted structure for DRAMP00293.

Physicochemical Information

    • Formula

    • C209H352N80O59S10

    • Absent Amino Acids

    • HTY

    • Common Amino Acids

    • CR

    • Mass

    • 5250.19

    • PI

    • 9.77

    • Basic Residues

    • 11

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +9

    • Boman Index

    • -140.97

    • Hydrophobicity

    • -0.719

    • Aliphatic Index

    • 33.19

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 6000

    • Absorbance 280nm

    • 130.43

    • Polar Residues

    • 20

DRAMP00293

DRAMP00293 chydropathy plot

Comments Information

    • Function

    • Inhibits protein translation in cell-free systems.

    • PTM

    • Contains four disulfide bonds 3-47; 14-34; 20-21; 24-43.

    • Caution

    • Was initially thought to be a thionin.

Literature Information

  • ·Literature 1

    • Title

    • Primary structure and inhibition of protein synthesis in eukaryotic cell-free system of a novel thionin, gamma-hordothionin, from barley endosperm.

    • Reference

    • Eur I Biochem 1990;194:533-539.

    • Author

    • Mendez E, Moreno A, Colilla F.J, Pelaez F, Limas G.G, Mendez R, Soriano F, Salinas M, de Haro C.
  • ·Literature 2

    • Title

    • Solution structure of gamma 1-H and gamma 1-P thionins from barley and wheat endosperm determined by 1H-NMR: a structural motif common to toxic arthropod proteins.

    • Reference

    • Biochemistry. 1993 Jan 19;32(2):715-724.

    • Author

    • Bruix M, Jim©nez MA, Santoro J, Gonz¡lez C, Colilla FJ, M©ndez E, Rico M.