General Information

    • DRAMP ID

    • DRAMP00297

    • Peptide Name

    • U1-theraphotoxin-Pc1a (U1-TRTX-Pc1a; Psalmopeotoxin-1; PcFK1; Plants)

    • Source

    • Psalmopoeus cambridgei (Trinidad chevron tarantula)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • ACGILHDNCVYVPAQNPCCRGLQCRYGKCLVQV

    • Sequence Length

    • 33

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antiplasmodial, Cytotoxic

    • Target Organism

    • Plasmodium falciparum (IC50=1.59 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00297 helical wheel diagram

    • PDB ID

    • 1X5V resolved by NMR.
  • 1X5V-> 

    • Predicted Structure

    • There is no predicted structure for DRAMP00297.

Physicochemical Information

    • Formula

    • C153H247N47O43S6

    • Absent Amino Acids

    • EFMSTW

    • Common Amino Acids

    • C

    • Mass

    • 3625.29

    • PI

    • 8.35

    • Basic Residues

    • 4

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +3

    • Boman Index

    • -28.99

    • Hydrophobicity

    • 0.218

    • Aliphatic Index

    • 88.48

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 104.84

    • Polar Residues

    • 13

DRAMP00297

DRAMP00297 chydropathy plot

Comments Information

    • Function

    • Possess strong antiplasmodial activity against the intra-erythrocyte stage of Plasmodium falciparum in vitro. Interacts with infected and healthy erythrocytes. Does not lyse erythrocytes, is not cytotoxic to nucleated mammalian cells, and does not inhibit neuromuscular function. Has neither antibacterial nor antifungal activity.

    • Tissue specificity

    • Expressed by the venom gland.

    • Domain

    • The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin.

    • PTM

    • Contains three disulfide bonds and C-terminal amidation.

Literature Information

  • ·Literature 1

    • Title

    • Isolation and characterization of Psalmopeotoxin I and II: two novel antimalarial peptides from the venom of the tarantula Psalmopoeus cambridgei.

    • Reference

    • FEBS Lett. 2004 Aug 13;572(1-3):109-117.

    • Author

    • Choi SJ, Parent R, Guillaume C, Deregnaucourt C, Delarbre C, Ojcius DM, Montagne JJ, C©l©rier ML, Phelipot A, Amiche M, Molgo J, Camadro JM, Guette C.
  • ·Literature 2

    • Title

    • Solution structure of PcFK1, a spider peptide active against Plasmodium falciparum.

    • Reference

    • Protein Sci. 2006 Mar;15(3):628-634.

    • Author

    • Pimentel C, Choi SJ, Chagot B, Guette C, Camadro JM, Darbon H.