• DRAMP ID

    • DRAMP00297
    • Peptide Name

    • U1-theraphotoxin-Pc1a (U1-TRTX-Pc1a; Psalmopeotoxin-1; PcFK1; Plants)
    • Source

    • Psalmopoeus cambridgei (Trinidad chevron tarantula)
    • Family

    • Unknown
    • Gene

    • Unknown
    • Sequence

    • ACGILHDNCVYVPAQNPCCRGLQCRYGKCLVQV
    • Sequence Length

    • 33
    • Evidence code

    • Protein level
    • Biological Activity

    • Antiplasmodial, Cytotoxic
    • Target Organism

      • Plasmodium falciparum (IC50=1.59 µM).
    • Hemolytic activity

    • Unknown
    • Binding Target

    • Unknown
    • Structure

    • Combine helix and strand structure
    • Structure Description

    • Unknown
    • PDB ID

    • 1X5V resolved by NMR.
    • DRAMP00297 helical wheel diagram
    • 1X5V-> 
    • Formula

    • C153H247N47O43S6
    • Absent Amino Acids

    • EFMSTW
    • Common Amino Acids

    • C
    • Mass

    • 4196.3
    • PI

    • 8.12
    • Basic Residues

    • 4
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 10
    • Boman Index

    • -28.99
    • Hydrophobicity

    • 21.82
    • Aliphatic Index

    • 88.48
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3355
    • Absorbance 280nm

    • 104.84
    • Polar Residues

    • 13

DRAMP00297

DRAMP00297 chydropathy plot
    • Function

    • Possess strong antiplasmodial activity against the intra-erythrocyte stage of Plasmodium falciparum in vitro. Interacts with infected and healthy erythrocytes. Does not lyse erythrocytes, is not cytotoxic to nucleated mammalian cells, and does not inhibit neuromuscular function. Has neither antibacterial nor antifungal activity.
    • Tissue specificity

    • Expressed by the venom gland.
    • Domain

    • The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin.
    • PTM

    • Contains three disulfide bonds and C-terminal amidation.
  • Literature 1
    • Reference

    • FEBS Lett. 2004 Aug 13;572(1-3):109-117.
    • Author

    • Choi SJ, Parent R, Guillaume C, Deregnaucourt C, Delarbre C, Ojcius DM, Montagne JJ, C©l©rier ML, Phelipot A, Amiche M, Molgo J, Camadro JM, Guette C.
    • Title

    • Isolation and characterization of Psalmopeotoxin I and II: two novel antimalarial peptides from the venom of the tarantula Psalmopoeus cambridgei.
  • Literature 2
    • Reference

    • Protein Sci. 2006 Mar;15(3):628-634.
    • Author

    • Pimentel C, Choi SJ, Chagot B, Guette C, Camadro JM, Darbon H.
    • Title

    • Solution structure of PcFK1, a spider peptide active against Plasmodium falciparum.