General Information

    • DRAMP ID

    • DRAMP00300

    • Peptide Name

    • Antifungal protein 1 (Pa-AFP1; Plant defensin)

    • Source

    • Passiflora alata (Winged-stem passion flower) (Fragrant granadilla)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • PGAGSQEERMQGQMEGQDFSHEERFLSMVRE

    • Sequence Length

    • 31

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00300 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00300.

Physicochemical Information

    • Formula

    • C147H228N46O53S3

    • Absent Amino Acids

    • CIKNTWY

    • Common Amino Acids

    • E

    • Mass

    • 3583.88

    • PI

    • 4.54

    • Basic Residues

    • 4

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 5

    • Net Charge

    • -3

    • Boman Index

    • -103.82

    • Hydrophobicity

    • -1.281

    • Aliphatic Index

    • 25.16

    • Half Life

      • Mammalian:>20 hour
      • Yeast:>20 hour
      • E.coli:?

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 7

DRAMP00300

DRAMP00300 chydropathy plot

Comments Information

    • Function

    • Has antifungal activity against C. gloeosporioides but not against Botrytis cinerea and Fusarium sp. or against various yeasts. Has no antibacterial activity.

    • Subunit structure

    • Heterodimer; disulfide-linked.

    • PTM

    • Disulfide bonds.

Literature Information

  • ·Literature 1

    • Title

    • Identification of a Passiflora alata Curtis dimeric peptide showing identity with 2S albumins.

    • Reference

    • Peptides. 2011 May;32(5):868-874.

    • Author

    • Ribeiro SM, Almeida RG, Pereira CA, Moreira JS, Pinto MF, Oliveira AC, Vasconcelos IM, Oliveira JT, Santos MO, Dias SC, Franco OL.