General Information

    • DRAMP ID

    • DRAMP00303

    • Peptide Name

    • Basic endochitinase CH1 (Plant defensin)

    • Source

    • Castanea sativa (Sweet chestnut)

    • Family

    • Belongs to the glycosyl hydrolase 19 family (Chitinase class I subfamily)

    • Gene

    • Not found

    • Sequence

    • ACGGGGGDVGSLISASLFDQMLKYRNDPRCCXXGF

    • Sequence Length

    • 35

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00303 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00303.

Physicochemical Information

    • Formula

    • C143H220N42O44S4

    • Absent Amino Acids

    • EHTW

    • Common Amino Acids

    • G

    • Mass

    • 3618.51

    • PI

    • 6.06

    • Basic Residues

    • 3

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 9

    • Net Charge

    • 0

    • Boman Index

    • -38

    • Hydrophobicity

    • 0.006

    • Aliphatic Index

    • 58.57

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1615

    • Absorbance 280nm

    • 47.5

    • Polar Residues

    • 15

DRAMP00303

DRAMP00303 chydropathy plot

Comments Information

    • Function

    • Defense against chitin containing fungal pathogens.

    • Catalytic activity

    • Random hydrolysis of N-acetyl-beta-D-glucosaminide (1->4)-beta-linkages in chitin and chitodextrins.

Literature Information

  • ·Literature 1

    • Title

    • Basic Endochitinases Are Major Proteins in Castanea sativa Cotyledons.

    • Reference

    • Plant Physiol. 1992 Oct;100(2):778-783.

    • Author

    • Collada C, Casado R, Fraile A, Aragoncillo C.