• DRAMP ID

    • DRAMP00303
    • Peptide Name

    • Basic endochitinase CH1 (Plant defensin)
    • Source

    • Castanea sativa (Sweet chestnut)
    • Family

    • Belongs to the glycosyl hydrolase 19 family (Chitinase class I subfamily)
    • Gene

    • Unknown
    • Sequence

    • ACGGGGGDVGSLISASLFDQMLKYRNDPRCCXXGF
    • Sequence Length

    • 35
    • Evidence code

    • Protein level
    • Biological Activity

    • Antifungal, Antimicrobial
    • Target Organism

      • No MICs found on DRAMP database
    • Hemolytic activity

    • Unknown
    • Binding Target

    • Unknown
    • Structure

    • Unknown
    • Structure Description

    • Unknown
    • DRAMP00303 helical wheel diagram
    • Formula

    • C143H220N42O44S4
    • Absent Amino Acids

    • EHTW
    • Common Amino Acids

    • G
    • Mass

    • 4186.47
    • PI

    • 6.18
    • Basic Residues

    • 3
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 9
    • Boman Index

    • -38
    • Hydrophobicity

    • 0.57
    • Aliphatic Index

    • 58.57
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1615
    • Absorbance 280nm

    • 47.5
    • Polar Residues

    • 15

DRAMP00303

DRAMP00303 chydropathy plot
    • Function

    • Defense against chitin containing fungal pathogens.
    • Catalytic activity

    • Random hydrolysis of N-acetyl-beta-D-glucosaminide (1->4)-beta-linkages in chitin and chitodextrins.
  • Literature 1
    • Reference

    • Plant Physiol. 1992 Oct;100(2):778-783.
    • Author

    • Collada C, Casado R, Fraile A, Aragoncillo C.
    • Title

    • Basic Endochitinases Are Major Proteins in Castanea sativa Cotyledons.