General Information

    • DRAMP ID

    • DRAMP00305

    • Peptide Name

    • Endochitinase 1 (Plant defensin)

    • Source

    • Capsicum chinense (Scotch bonnet) (Bonnet pepper)

    • Family

    • Belongs to the glycosyl hydrolase 21 family (Chitinase class I subfamily)

    • Gene

    • Not found

    • Sequence

    • NNFYSYNAFITAAKSFPGFGTTGDTAVRGPIQISYNYNYGPCGR

    • Sequence Length

    • 44

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00305 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00305.

Physicochemical Information

    • Formula

    • C218H311N57O65S

    • Absent Amino Acids

    • EHLMW

    • Common Amino Acids

    • G

    • Mass

    • 4802.27

    • PI

    • 8.99

    • Basic Residues

    • 3

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +2

    • Boman Index

    • -59.15

    • Hydrophobicity

    • -0.402

    • Aliphatic Index

    • 42.27

    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7450

    • Absorbance 280nm

    • 173.26

    • Polar Residues

    • 24

DRAMP00305

DRAMP00305 chydropathy plot

Comments Information

    • Function

    • Defense against chitin containing fungal pathogens.

    • Catalytic activity

    • Random hydrolysis of N-acetyl-beta-D-glucosaminide (1->4)-beta-linkages in chitin and chitodextrins.

Literature Information

  • ·Literature 1

    • Title

    • Not found

    • Reference

    • Submitted (JUL-2008) to UniProtKB

    • Author

    • Gomez Ros L.V, Almagro L, Ros Barcelo A, Pedreno M.A.