• DRAMP ID

    • DRAMP00305
    • Peptide Name

    • Endochitinase 1 (Plant defensin)
    • Source

    • Capsicum chinense (Scotch bonnet) (Bonnet pepper)
    • Family

    • Belongs to the glycosyl hydrolase 21 family (Chitinase class I subfamily)
    • Gene

    • Unknown
    • Sequence

    • NNFYSYNAFITAAKSFPGFGTTGDTAVRGPIQISYNYNYGPCGR
    • Sequence Length

    • 44
    • Evidence code

    • Protein level
    • Biological Activity

    • Antifungal, Antimicrobial
    • Target Organism

      • No MICs found on DRAMP database
    • Hemolytic activity

    • Unknown
    • Binding Target

    • Unknown
    • Structure

    • Unknown
    • Structure Description

    • Unknown
    • DRAMP00305 helical wheel diagram
    • Formula

    • C218H311N57O65S
    • Absent Amino Acids

    • EHLMW
    • Common Amino Acids

    • G
    • Mass

    • 5569.41
    • PI

    • 9.08
    • Basic Residues

    • 3
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 12
    • Boman Index

    • -59.15
    • Hydrophobicity

    • -40.23
    • Aliphatic Index

    • 42.27
    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 7450
    • Absorbance 280nm

    • 173.26
    • Polar Residues

    • 24

DRAMP00305

DRAMP00305 chydropathy plot
    • Function

    • Defense against chitin containing fungal pathogens.
    • Catalytic activity

    • Random hydrolysis of N-acetyl-beta-D-glucosaminide (1->4)-beta-linkages in chitin and chitodextrins.
  • Literature 1
    • Reference

    • Submitted (JUL-2008) to UniProtKB
    • Author

    • Gomez Ros L.V, Almagro L, Ros Barcelo A, Pedreno M.A.
    • Title

    • Unknown