General Information

    • DRAMP ID

    • DRAMP00315

    • Peptide Name

    • Endochitinase 4 (CHIT 4; Plant defensin)

    • Source

    • Arachis hypogaea (Peanut)

    • Family

    • Belongs to the glycosyl hydrolase 31 family (Chitinase class I subfamily)

    • Gene

    • Not found

    • Sequence

    • MTPQGNKPSCHDVITNAWRPTATDSAAGRAPGYGVITNIINGGLDC

    • Sequence Length

    • 46

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Chitin-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00315 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00315.

Physicochemical Information

    • Formula

    • C201H319N61O66S3

    • Absent Amino Acids

    • EF

    • Common Amino Acids

    • G

    • Mass

    • 4742.29

    • PI

    • 6.5

    • Basic Residues

    • 4

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +1

    • Boman Index

    • -63.49

    • Hydrophobicity

    • -0.307

    • Aliphatic Index

    • 65.87

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7115

    • Absorbance 280nm

    • 158.11

    • Polar Residues

    • 20

DRAMP00315

DRAMP00315 chydropathy plot

Comments Information

    • Function

    • Defense against chitin containing fungal and bacterial pathogens.

    • Catalytic activity

    • Random hydrolysis of N-acetyl-beta-D-glucosaminide (1->4)-beta-linkages in chitin and chitodextrins.

    • Induction

    • By glucan elicitor, and to a lesser extent by yeast extract, Phytophthora megasperma elicitor, UV light and dilution.

Literature Information

  • ·Literature 1

    • Title

    • Elicitor-specific induction of one member of the chitinase gene family in Arachis hypogaea.

    • Reference

    • Mol Gen Genet. 1990 Dec;224(3):469-476.

    • Author

    • Herget T, Schell J, Schreier PH.