General Information

    • DRAMP ID

    • DRAMP00316

    • Peptide Name

    • Endochitinase 1A (CHIT 1A; Plant defensin)

    • Source

    • Arachis hypogaea (Peanut)

    • Family

    • Belongs to the glycosyl hydrolase 32 family (Chitinase class I subfamily)

    • Gene

    • Not found

    • Sequence

    • MTAQGNKPSSHDVITGRWTPSAADRAAGRVSGFGVITNIINGGLDC

    • Sequence Length

    • 46

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Chitin-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00316 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00316.

Physicochemical Information

    • Formula

    • C199H321N63O65S2

    • Absent Amino Acids

    • EY

    • Common Amino Acids

    • G

    • Mass

    • 4700.24

    • PI

    • 8

    • Basic Residues

    • 5

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +2

    • Boman Index

    • -69.18

    • Hydrophobicity

    • -0.161

    • Aliphatic Index

    • 72.17

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 122.22

    • Polar Residues

    • 19

DRAMP00316

DRAMP00316 chydropathy plot

Comments Information

    • Function

    • Defense against chitin containing fungal and bacterial pathogens.

    • Catalytic activity

    • Random hydrolysis of N-acetyl-beta-D-glucosaminide (1->4)-beta-linkages in chitin and chitodextrins.

    • Induction

    • By yeast extract and dilution. Slight induction by glucan elicitor.

Literature Information

  • ·Literature 1

    • Title

    • Elicitor-specific induction of one member of the chitinase gene family in Arachis hypogaea.

    • Reference

    • Mol Gen Genet. 1990 Dec;224(3):469-476.

    • Author

    • Herget T, Schell J, Schreier PH.