General Information

    • DRAMP ID

    • DRAMP00320

    • Peptide Name

    • Acyclotide phyb-K (Plant defensin)

    • Source

    • Petunia hybrida (Petunia)

    • Family

    • Belongs to the cyclotide family (Bracelet subfamily)

    • Gene

    • Not found

    • Sequence

    • MARVNSLKCALCFIVLILFVQLNCIPETRVMAVELSRVFLQTSSTDCGEPCVYIPCTITALLGCSCLNKVCVRP

    • Sequence Length

    • 74

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Unknown

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00320 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00320.

Physicochemical Information

    • Formula

    • C356H593N93O99S11

    • Absent Amino Acids

    • HW

    • Common Amino Acids

    • LCV

    • Mass

    • 8112.85

    • PI

    • 8.11

    • Basic Residues

    • 6

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 31

    • Net Charge

    • +2

    • Boman Index

    • -16.48

    • Hydrophobicity

    • 0.904

    • Aliphatic Index

    • 119.73

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1990

    • Absorbance 280nm

    • 27.26

    • Polar Residues

    • 25

DRAMP00320

DRAMP00320 chydropathy plot

Comments Information

    • Function

    • Probably participates in a plant defense mechanism (By similarity).

    • Tissue specificity

    • Expressed in midvein, lamina and periphery of leaves (at protein level).

    • Domain

    • The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin.

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Phosphate systemically inhibits development of arbuscular mycorrhiza in Petunia hybrida and represses genes involved in mycorrhizal functioning.

    • Reference

    • Plant J. 2010 Dec;64(6):1002-1017.

    • Author

    • Breuillin F, Schramm J, Hajirezaei M, Ahkami A, Favre P, Druege U, Hause B, Bucher M, Kretzschmar T, Bossolini E, Kuhlemeier C, Martinoia E, Franken P, Scholz U, Reinhardt D.
  • ·Literature 2

    • Title

    • Cyclotides associate with leaf vasculature and are the products of a novel precursor in petunia (Solanaceae).

    • Reference

    • J Biol Chem. 2012 Aug 3;287(32):27033-46.

    • Author

    • Poth AG, Mylne JS, Grassl J, Lyons RE, Millar AH, Colgrave ML, Craik DJ.