• DRAMP ID

    • DRAMP00320
    • Peptide Name

    • Acyclotide phyb-K (Plant defensin)
    • Source

    • Petunia hybrida (Petunia)
    • Family

    • Belongs to the cyclotide family (Bracelet subfamily)
    • Gene

    • Unknown
    • Sequence

    • MARVNSLKCALCFIVLILFVQLNCIPETRVMAVELSRVFLQTSSTDCGEPCVYIPCTITALLGCSCLNKVCVRP
    • Sequence Length

    • 74
    • Evidence code

    • Protein level
    • Biological Activity

    • unknow
    • Target Organism

      • No MICs found on DRAMP database
    • Hemolytic activity

    • Unknown
    • Binding Target

    • Unknown
    • Structure

    • Unknown
    • Structure Description

    • Unknown
    • DRAMP00320 helical wheel diagram
    • Formula

    • C356H593N93O99S11
    • Absent Amino Acids

    • HW
    • Common Amino Acids

    • LCV
    • Mass

    • 9415.16
    • PI

    • 7.91
    • Basic Residues

    • 6
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 31
    • Boman Index

    • -16.48
    • Hydrophobicity

    • 90.41
    • Aliphatic Index

    • 119.73
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1990
    • Absorbance 280nm

    • 27.26
    • Polar Residues

    • 25

DRAMP00320

DRAMP00320 chydropathy plot
    • Function

    • Probably participates in a plant defense mechanism (By similarity).
    • Tissue specificity

    • Expressed in midvein, lamina and periphery of leaves (at protein level).
    • Domain

    • The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin.
    • PTM

    • Contains three disulfide bonds (By similarity).
  • Literature 1
    • Reference

    • Plant J. 2010 Dec;64(6):1002-1017.
    • Author

    • Breuillin F, Schramm J, Hajirezaei M, Ahkami A, Favre P, Druege U, Hause B, Bucher M, Kretzschmar T, Bossolini E, Kuhlemeier C, Martinoia E, Franken P, Scholz U, Reinhardt D.
    • Title

    • Phosphate systemically inhibits development of arbuscular mycorrhiza in Petunia hybrida and represses genes involved in mycorrhizal functioning.
  • Literature 2
    • Reference

    • J Biol Chem. 2012 Aug 3;287(32):27033-46.
    • Author

    • Poth AG, Mylne JS, Grassl J, Lyons RE, Millar AH, Colgrave ML, Craik DJ.
    • Title

    • Cyclotides associate with leaf vasculature and are the products of a novel precursor in petunia (Solanaceae).