General Information

    • DRAMP ID

    • DRAMP00321

    • Peptide Name

    • Acyclotide phyb-M (Plant defensin)

    • Source

    • Petunia hybrida (Petunia)

    • Family

    • Belongs to the cyclotide family (Bracelet subfamily)

    • Gene

    • Not found

    • Sequence

    • QSISCAESCVWIPCATSLIGCSCVNSRCIYSK

    • Sequence Length

    • 32

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Unknown

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00321 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00321.

Physicochemical Information

    • Formula

    • C142H231N39O46S6

    • Absent Amino Acids

    • DFHM

    • Common Amino Acids

    • S

    • Mass

    • 3412.99

    • PI

    • 7.77

    • Basic Residues

    • 2

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +1

    • Boman Index

    • -18.72

    • Hydrophobicity

    • 0.606

    • Aliphatic Index

    • 85.31

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 237.58

    • Polar Residues

    • 17

DRAMP00321

DRAMP00321 chydropathy plot

Comments Information

    • Function

    • Probably participates in a plant defense mechanism (By similarity).

    • Tissue specificity

    • Expressed in midvein, lamina and periphery of leaves (at protein level).

    • Domain

    • The presence of a 'disulfide through disulfide knot' structurally defines this protein as a knottin.

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Cyclotides associate with leaf vasculature and are the products of a novel precursor in petunia (Solanaceae).

    • Reference

    • J Biol Chem. 2012 Aug 3;287(32):27033-46.

    • Author

    • Poth AG, Mylne JS, Grassl J, Lyons RE, Millar AH, Colgrave ML, Craik DJ.