General Information

    • DRAMP ID

    • DRAMP00330

    • Peptide Name

    • Pathogenesis-related protein (PR-1; Plant defensin)

    • Source

    • Cucumis melo (Muskmelon)

    • Family

    • Belongs to the CRISP family

    • Gene

    • Not found

    • Sequence

    • DFVDAHNAARAQVGVGPVHWTVDAYARQYANDRNLVHSATR

    • Sequence Length

    • 41

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Unknown

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00330 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00330.

Physicochemical Information

    • Formula

    • C198H299N65O60

    • Absent Amino Acids

    • CEIKM

    • Common Amino Acids

    • A

    • Mass

    • 4549.95

    • PI

    • 7.02

    • Basic Residues

    • 7

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 17

    • Net Charge

    • +3

    • Boman Index

    • -97.53

    • Hydrophobicity

    • -0.512

    • Aliphatic Index

    • 71.46

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8480

    • Absorbance 280nm

    • 212

    • Polar Residues

    • 10

DRAMP00330

DRAMP00330 chydropathy plot

Comments Information

    • Function

    • Probably involved in the defense reaction of plants against pathogens (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Novel plant pathogenesis-related protein family involved in food allergy.

    • Reference

    • J Allergy Clin Immunol. 2004 Oct;114(4):896-899.

    • Author

    • Asensio T, Crespo JF, Sanchez-Monge R, Lopez-Torrejon G, Somoza ML, Rodriguez J, Salcedo G.