General Information

    • DRAMP ID

    • DRAMP00341

    • Peptide Name

    • Antifungal protein ginkbilobin-1 (Ginkbilobin, GNL; Plants)

    • Source

    • Ginkgo biloba (Ginkgo) (Maidenhair tree)

    • Family

    • Not found

    • Gene

    • GNK1

    • Sequence

    • ANTAFVSSAHNTQKIPAGAPFNRNLRAMLADLRQNAAFAG

    • Sequence Length

    • 40

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral, Antifungal

    • Target Organism

      • Gram-positive bacterium: Staphylococcus aureus;
      • Gram-negative bacteria: Pseudomonas aeruginosa, Escherichia coli.
      • Fuungi: Botrytis cinerea, Mycosphaerella arachidicola, Fusarium oxysporum, Rhizoctonia solani, Coprinus comatus,

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00341 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00341.

Physicochemical Information

    • Formula

    • C183H291N59O54S

    • Absent Amino Acids

    • CEWY

    • Common Amino Acids

    • A

    • Mass

    • 4213.75

    • PI

    • 11.71

    • Basic Residues

    • 5

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 18

    • Net Charge

    • +4

    • Boman Index

    • -64.92

    • Hydrophobicity

    • -0.18

    • Aliphatic Index

    • 71.25

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 11

DRAMP00341

DRAMP00341 chydropathy plot

Comments Information

    • Function

    • Also inhibits HIV-1 reverse transcriptase and proliferation of murine splenocytes.

Literature Information

  • ·Literature 1

    • Title

    • Ginkbilobin, a novel antifungal protein from Ginkgo biloba seeds with sequence similarity to embryo-abundant protein.

    • Reference

    • Biochem Biophys Res Commun. 2000 Dec 20;279(2):407-411.

    • Author

    • Wang H, Ng T.B.