• DRAMP ID

    • DRAMP00342
    • Peptide Name

    • Antifungal protein R (Plant defensin)
    • Source

    • Hordeum vulgare (Barley)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • ATITVVNRCSYTVWPGALPGGGVRLDPGQRWALNMPAGTAGAAV
    • Sequence Length

    • 44
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antifungal
    • Target Organism

      • Fungi: Trichoderma viridae, Candida albicans.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00342 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00342.
    • Formula

    • C197H312N58O56S2
    • Absent Amino Acids

    • EFHK
    • Common Amino Acids

    • AG
    • Mass

    • 4453.12
    • PI

    • 9.5
    • Basic Residues

    • 3
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 18
    • Net Charge

    • +2
    • Boman Index

    • -18.7
    • Hydrophobicity

    • 0.239
    • Aliphatic Index

    • 84.32
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 12490
    • Absorbance 280nm

    • 290.47
    • Polar Residues

    • 16

DRAMP00342

DRAMP00342 chydropathy plot
    • Function

    • Has antifungal activity. Inhibits the growth of Trichoderma viridae and Candida albicans.
  • ·Literature 1
    • Title

    • Two antifungal thaumatin-like proteins from barley grain.
    • Reference

    • FEBS Lett. 1991 Oct 7;291(1):127-131.
    • Author

    • Hejgaard J, Jacobsen S, Svendsen I.