General Information

    • DRAMP ID

    • DRAMP00343

    • Peptide Name

    • Antifungal protein S (Plant defensin)

    • Source

    • Hordeum vulgare (Barley)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • ATFTVINKCQYTVWAAAVPAGGGQKLDAGQTWSIXXP

    • Sequence Length

    • 37

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Trichoderma viridae, Candida albicans.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00343 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00343.

Physicochemical Information

    • Formula

    • C166H249N43O46S

    • Absent Amino Acids

    • EHMR

    • Common Amino Acids

    • A

    • Mass

    • 3873.82

    • PI

    • 8.22

    • Basic Residues

    • 2

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +1

    • Boman Index

    • -6.48

    • Hydrophobicity

    • 0.127

    • Aliphatic Index

    • 71.35

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12490

    • Absorbance 280nm

    • 346.94

    • Polar Residues

    • 12

DRAMP00343

DRAMP00343 chydropathy plot

Comments Information

    • Function

    • Has antifungal activity. Inhibits the growth of Trichoderma viridae and Candida albicans.

Literature Information

  • ·Literature 1

    • Title

    • Two antifungal thaumatin-like proteins from barley grain.

    • Reference

    • FEBS Lett. 1991 Oct 7;291(1):127-131.

    • Author

    • Hejgaard J, Jacobsen S, Svendsen I.