General Information

    • DRAMP ID

    • DRAMP00344

    • Peptide Name

    • Non-specific lipid-transfer protein 6 (LTP; Plants)

    • Source

    • Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)

    • Family

    • Belongs to the plant LTP family

    • Gene

    • LTP6

    • Sequence

    • AISYDQVKSSLLPCVGYVRGNNARPAPPNYCKGIRSLKSAARIRLDRQAACKCIKSLAADISDINYGVAAGLPGQCNVHIPYKISPSIDCKRVK

    • Sequence Length

    • 94

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Not found

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Lipid-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00344 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00344.

Physicochemical Information

    • Formula

    • C441H729N133O127S6

    • Absent Amino Acids

    • EFMTW

    • Common Amino Acids

    • A

    • Mass

    • 10118.81

    • PI

    • 9.66

    • Basic Residues

    • 16

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 32

    • Net Charge

    • +11

    • Boman Index

    • -146.95

    • Hydrophobicity

    • -0.164

    • Aliphatic Index

    • 92.45

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7825

    • Absorbance 280nm

    • 84.14

    • Polar Residues

    • 31

DRAMP00344

DRAMP00344 chydropathy plot

Comments Information

    • Function

    • Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity).

    • Tissue specificity

    • Specifically expressed in fiber cells.

Literature Information

  • ·Literature 1

    • Title

    • Cloning and characterization of a cotton lipid transfer protein gene specifically expressed in fiber cells.

    • Reference

    • Biochim Biophys Acta. 1997 Jan 21;1344(2):111-114.

    • Author

    • Ma DP, Liu HC, Tan H, Creech RG, Jenkins JN, Chang YF.