General Information

    • DRAMP ID

    • DRAMP00345

    • Peptide Name

    • Probable non-specific lipid-transfer protein (LTP; B-FABP; Plants)

    • Source

    • Hordeum vulgare (Barley)

    • Family

    • Belongs to the plant LTP family

    • Gene

    • LTP2

    • Sequence

    • ACEPAQLAVCASAILGGTKPSGECCGNLRAQQGCLCQYVKDPNYGHYVSSPHARDTLNLCGIPVPHC

    • Sequence Length

    • 67

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Not found

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Lipid-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00345 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00345.

Physicochemical Information

    • Formula

    • C296H468N88O92S8

    • Absent Amino Acids

    • FMW

    • Common Amino Acids

    • CAG

    • Mass

    • 6987.99

    • PI

    • 6.98

    • Basic Residues

    • 7

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 19

    • Net Charge

    • +3

    • Boman Index

    • -62.21

    • Hydrophobicity

    • -0.069

    • Aliphatic Index

    • 74.33

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4970

    • Absorbance 280nm

    • 75.3

    • Polar Residues

    • 27

DRAMP00345

DRAMP00345 chydropathy plot

Comments Information

    • Function

    • Potential phospholipid transfer protein.

    • Tissue specificity

    • Aleurone.

    • Developmental stage

    • Maximum mRNA abundance around mid-phase of grain development.

    • PTM

    • Contains four disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • The promoter of the barley aleurone-specific gene encoding a putative 7 kDa lipid transfer protein confers aleurone cell-specific expression in transgenic rice.

    • Reference

    • Plant J. 1994 Dec;6(6):849-860.

    • Author

    • Kalla R, Shimamoto K, Potter R, Nielsen PS, Linnestad C, Olsen OA.