General Information

    • DRAMP ID

    • DRAMP00347

    • Peptide Name

    • Non-specific lipid-transfer protein 3 (LTP 3; CW-19; CW-20; Plants)

    • Source

    • Hordeum vulgare (Barley)

    • Family

    • Belongs to the plant LTP family

    • Gene

    • LTP3

    • Sequence

    • AISCGQVSSALSPCISYARGNGAKPPVACCSGVKRLAGAAQSTADKQAACRCLKSLATSIKGINMGKVSGVPGKCGVSVPFPISMSTDCNKVH

    • Sequence Length

    • 93

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

      • Fungi: Fusarim solani (EC50=3-20×10-6 M), Pseudomonas solanacearum (EC50=3-6×10-7 M), Pythium aphanidermatum, Clavibacter michiganensis subsp. Sepedonicus (EC50=l-3×10-7 M).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Lipid-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00347 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00347.

Physicochemical Information

    • Formula

    • C390H658N118O121S10

    • Absent Amino Acids

    • EW

    • Common Amino Acids

    • SA

    • Mass

    • 9256.83

    • PI

    • 9.47

    • Basic Residues

    • 12

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 30

    • Net Charge

    • +10

    • Boman Index

    • -74.21

    • Hydrophobicity

    • 0.174

    • Aliphatic Index

    • 75.59

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1990

    • Absorbance 280nm

    • 21.63

    • Polar Residues

    • 38

DRAMP00347

DRAMP00347 chydropathy plot

Comments Information

    • Function

    • Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.

    • PTM

    • Contains four disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Lipid transfer proteins (nsLTPs) from barley and maize leaves are potent inhibitors of bacterial and fungal plant pathogens.

    • Reference

    • FEBS Lett. 1993 Jan 25;316(2):119-122.

    • Author

    • Molina A, Segura A, García-Olmedo F.
  • ·Literature 2

    • Title

    • Developmental and pathogen-induced expression of three barley genes encoding lipid transfer proteins.

    • Reference

    • Plant J. 1993 Dec;4(6):983-991.

    • Author

    • Molina A, Garc­a-Olmedo F.