• DRAMP ID

    • DRAMP00349
    • Peptide Name

    • Non-specific lipid-transfer protein 4.2 (LTP 4.2; Low-temperature-responsive protein 4.9; Plants)
    • Source

    • Hordeum vulgare (Barley)
    • Family

    • Belongs to the plant LTP family
    • Gene

    • LTP4.2
    • Sequence

    • AISCGQVSSALSPCISYARGNGAKPPVACCSGVKRLAGAAQSTADKQAACKCIKSAAGGLNAGKAAGIPSMCGVSVPYAISASVDCSKIR
    • Sequence Length

    • 90
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Not found
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Lipid-binding
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00349 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP00349.
    • Formula

    • C364H615N111O116S9
    • Absent Amino Acids

    • EFHW
    • Common Amino Acids

    • A
    • Mass

    • 8691.1
    • PI

    • 9.33
    • Basic Residues

    • 10
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 33
    • Net Charge

    • +8
    • Boman Index

    • -54.91
    • Hydrophobicity

    • 0.299
    • Aliphatic Index

    • 78.33
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3480
    • Absorbance 280nm

    • 39.1
    • Polar Residues

    • 36

DRAMP00349

DRAMP00349 chydropathy plot
    • Function

    • Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.
    • Induction

    • By cold.
    • PTM

    • Contains four disulfide bonds (By similarity).
  • ·Literature 1
    • Title

    • Two cold-inducible genes encoding lipid transfer protein LTP4 from barley show differential responses to bacterial pathogens.
    • Reference

    • Mol Gen Genet. 1996 Aug 27;252(1-2):162-168.
    • Author

    • Molina A, Diaz I, Vasil IK, Carbonero P, Garc­a-Olmedo F.