General Information

    • DRAMP ID

    • DRAMP00351

    • Peptide Name

    • Non-specific lipid-transfer protein 1 (LTP 1; PR-14; Plant defensin)

    • Source

    • Nicotiana tabacum (Common tobacco)

    • Family

    • Belongs to the plant LTP family

    • Gene

    • LTP1

    • Sequence

    • AITCGQVTSNLAPCLAYLRNTGPLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTDCSKVQ

    • Sequence Length

    • 91

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Not found

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Lipid-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Alpha helix (5 helices; 50 residues)

    • Structure Description

    • The overall fold of tobacco LTP 1 includes four α-helices: H1 (Cys4-Leu18), H2 (Cys27-Val37), H3 (Glu42-Ala55) and H4 (Leu63-Thr72), followed by a C-terminal segment involving three γ-turns.

    • Helical Wheel Diagram

    • DRAMP00351 helical wheel diagram

    • PDB ID

    • 1T12 resolved by NMR.
  • 1T12-> 

    • Predicted Structure

    • There is no predicted structure for DRAMP00351.

Physicochemical Information

    • Formula

    • C387H654N116O124S8

    • Absent Amino Acids

    • FHMW

    • Common Amino Acids

    • AG

    • Mass

    • 9172.63

    • PI

    • 9.07

    • Basic Residues

    • 9

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 30

    • Net Charge

    • +6

    • Boman Index

    • -80.91

    • Hydrophobicity

    • 0.171

    • Aliphatic Index

    • 88.02

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3480

    • Absorbance 280nm

    • 38.67

    • Polar Residues

    • 41

DRAMP00351

DRAMP00351 chydropathy plot

Comments Information

    • Function

    • Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. Binds cis-unsaturated fatty acids and jasmonic acid with a higher affinity than linear chain fatty acids. Formation of the complex with jasmonic acid results in a conformational change facilitating the LPT1 binding on the elicitin plasma membrane receptor that is known to be involved in plant defense induction. May also play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.

    • Tissue specificity

    • High expression in leaf epidermis and shoot apex, and also in root epidermis during seedling germination.

    • PTM

    • Contains four disulfide bonds.

Literature Information

  • ·Literature 1

    • Title

    • Tissue-specific expression and promoter analysis of the tobacco Itp1 gene.

    • Reference

    • Plant Physiol. 1996 Oct;112(2):513-524.

    • Author

    • Canevascini S, Caderas D, Mandel T, Fleming AJ, Dupuis I, Kuhlemeier C.
  • ·Literature 2

    • Title

    • Solution structure of a tobacco lipid transfer protein exhibiting new biophysical and biological features.

    • Reference

    • Proteins. 2005 May 1;59(2):356-367.

    • Author

    • Da Silva P, Landon C, Industri B, Marais A, Marion D, Ponchet M, Vovelle F.